@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0870: (2016-01-22 )
MSHFAKVARVPGDPILGLLDAYRNDPRADKLDLGVGVYKDAQGLTPILRSVKLAEQRLVEQETTKSYVGGHGDALFAARLAELALGAASPLLLEQRADATQTPGGTGALRLAGDFIAHCLPGRGIWLSDPTWPIHETLFAAAGLKVSHYPYVSADNRLDVEAMLAGLERIPQGDVVLLHACCHNPTGFDLSHDDWRRVLDVVRRRELLPLIDFAYQGFGDGLEEDAWAVRLFAGELPEVLVTSSCSKNFGLYRDRVGALIVCAQNAEKLTDLRSQLAFLARNLWSTPPAHGAEVVAAILGDSELKGLWQEEVEGMRSRIASLRIGLVEALAPHGLAERFAHVGAQRGMFSYTGLSPQQVARLRDEHAVYLVSSGRANVAGLDARRLDRLAQAIAQVCAD

Atome Classification :

(95 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

3QP_A_15(3QPG)
AAT_ECOLI
[Raw transfer]




3QP_A_7(4DBC)
AAT_ECOLI
[Raw transfer]




PP3_C_3(1C9C)
AAT_ECOLI
[Raw transfer]




PLA_B_4(1ASL)
AAT_ECOLI
[Raw transfer]




PPD_A_3(1ARG)
AAT_ECOLI
[Raw transfer]




PPD_B_4(1ARG)
AAT_ECOLI
[Raw transfer]




PY5_C_3(1CQ7)
AAT_ECOLI
[Raw transfer]




PLA_A_3(1AJS)
AATC_PIG
[Raw transfer]




PPD_B_4(1ARH)
AAT_ECOLI
[Raw transfer]




PGU_D_4(1X28)
AAT_ECOLI
[Raw transfer]




PY6_C_3(1CQ8)
AAT_ECOLI
[Raw transfer]




PGU_C_3(1X28)
AAT_ECOLI
[Raw transfer]




PPD_A_3(1ARH)
AAT_ECOLI
[Raw transfer]




PLA_A_3(1ASL)
AAT_ECOLI
[Raw transfer]




PY4_C_3(1CQ6)
AAT_ECOLI
[Raw transfer]




PP3_A_2(4A00)
AAT_ECOLI
[Raw transfer]




PMG_D_4(1X29)
AAT_ECOLI
[Raw transfer]




HCI_C_3(1TOI)
AAT_ECOLI
[Raw transfer]




GUA_E_5(1CZC)
AAT_ECOLI
[Raw transfer]




HCI_C_3(1TOG)
AAT_ECOLI
[Raw transfer]




HCI_D_4(1TOG)
AAT_ECOLI
[Raw transfer]




HCI_C_3(1TOJ)
AAT_ECOLI
[Raw transfer]




PDG_C_3(1X2A)
AAT_ECOLI
[Raw transfer]




MAE_E_5(1ASD)
AAT_ECOLI
[Raw transfer]




MAE_D_4(1TOK)
AAT_ECOLI
[Raw transfer]




MAE_A_5(1QIR)
AAT_ECOLI
[Raw transfer]




PMG_C_3(1X29)
AAT_ECOLI
[Raw transfer]




MAE_C_3(1TOK)
AAT_ECOLI
[Raw transfer]




PMP_A_2(3ZZK)
AAT_ECOLI
[Raw transfer]




IVA_E_5(2D5Y)
AAT_ECOLI
[Raw transfer]




GUA_E_5(1AMS)
AAT_ECOLI
[Raw transfer]




PJ7_A_2(3PA9)
?
[Raw transfer]




IVA_E_5(2D63)
AAT_ECOLI
[Raw transfer]




PDG_D_4(1X2A)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ART)
AAT_ECOLI
[Raw transfer]




PMP_A_5(1AIC)
AAT_ECOLI
[Raw transfer]




PJ7_A_2(3PAA)
?
[Raw transfer]




PMP_A_3(3PAA)
?
[Raw transfer]




PMP_A_3(1AIA)
AAT_ECOLI
[Raw transfer]




PLP_A_2(3ZZJ)
AAT_ECOLI
[Raw transfer]




PMP_A_3(3PA9)
?
[Raw transfer]




PMP_C_3(1AMQ)
AAT_ECOLI
[Raw transfer]




PMP_C_3(1AMR)
AAT_ECOLI
[Raw transfer]




PMP_B_6(1AIC)
AAT_ECOLI
[Raw transfer]




NPL_C_3(1ASC)
AAT_ECOLI
[Raw transfer]




PMP_B_4(1AIA)
AAT_ECOLI
[Raw transfer]




PMP_A_3(1AIB)
AAT_ECOLI
[Raw transfer]




PLP_E_5(1AAM)
AAT_ECOLI
[Raw transfer]




PMP_B_5(1AIB)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1AHY)
AAT_ECOLI
[Raw transfer]




EDO_A_9(4F5L)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2AY1)
TYRB_PARDE
[Raw transfer]




PLP_B_6(1AHF)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1G4V)
AAT_ECOLI
[Raw transfer]




PMP_C_3(1AMS)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ARS)
AAT_ECOLI
[Raw transfer]




PLP_B_5(1AHX)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1QIR)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1ASM)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D7Y)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1G4X)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1CZC)
AAT_ECOLI
[Raw transfer]




PLP_A_3(5EAA)
AAT_ECOLI
[Raw transfer]




PLP_A_4(1AHF)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1AHX)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1B4X)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1QIS)
AAT_ECOLI
[Raw transfer]




PLP_B_5(1AHY)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1IX6)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1IX7)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D7Z)
AAT_ECOLI
[Raw transfer]




PLP_E_5(3AAT)
AAT_ECOLI
[Raw transfer]




PLP_B_6(1ASN)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ASG)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1ARI)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1ASA)
AAT_ECOLI
[Raw transfer]




PLP_A_5(2D66)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1YOO)
AAT_ECOLI
[Raw transfer]




PLP_A_5(1AHE)
AAT_ECOLI
[Raw transfer]




PLP_B_5(1ASM)
AAT_ECOLI
[Raw transfer]




NPL_C_3(1SPA)
AAT_ECOLI
[Raw transfer]




PLP_E_5(1ASF)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1CZE)
AAT_ECOLI
[Raw transfer]




PLP_B_5(1ARI)
AAT_ECOLI
[Raw transfer]




PLP_A_5(2D65)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1QIT)
AAT_ECOLI
[Raw transfer]




CHAIN_C_2(1AHG)
AAT_ECOLI
[Raw transfer]

-

PLP_B_6(1AHE)
AAT_ECOLI
[Raw transfer]




PLP_C_3(1AAW)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1IX8)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D5Y)
AAT_ECOLI
[Raw transfer]




NOP_C_3(1ASE)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D61)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D63)
AAT_ECOLI
[Raw transfer]




MPL_C_3(1ASD)
AAT_ECOLI
[Raw transfer]




CHAIN_D_4(1AHG)
AAT_ECOLI
[Raw transfer]

-

PLP_C_3(1ASB)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1G7W)
AAT_ECOLI
[Raw transfer]




PMP_E_5(2AAT)
AAT_ECOLI
[Raw transfer]




PLP_A_3(2D64)
AAT_ECOLI
[Raw transfer]




PLP_A_3(1G7X)
AAT_ECOLI
[Raw transfer]




EDO_B_6(4F5M)
AAT_ECOLI
[Raw transfer]




CH3_E_5(1ART)
AAT_ECOLI
[Raw transfer]




62 PsiBlast_CBE 97.3546%-113 - C1 -1QIR 3.2 AAT_ECOLI
21 PsiBlast_CBE 96.5246%-113 - C1 -3QPG 9.8 AAT_ECOLI
34 PsiBlast_CBE 96.4646%-112 - C1 -1ARG 9.3 AAT_ECOLI
8 PsiBlast_PDB 96.3446%-108 - C1 -1ARG 9.1 AAT_ECOLI
71 PsiBlast_CBE 96.3147%-110 - C1 -1YOO 5.0 AAT_ECOLI
25 PsiBlast_CBE 96.0446%-110 - C1 -1X29 9.6 AAT_ECOLI
61 PsiBlast_CBE 95.4846%-112 - C1 -1QIS 4.0 AAT_ECOLI
63 PsiBlast_CBE 95.2546%-110 - C1 -1QIT 3.6 AAT_ECOLI
37 PsiBlast_CBE 95.1846%-107 - C1 -1IX7 4.5 AAT_ECOLI
13 PsiBlast_PDB 95.1546%-109 - C1 -1X28 9.9 AAT_ECOLI
70 PsiBlast_CBE 95.0647%-110 - C1 -1CZC 4.4 AAT_ECOLI
86 PsiBlast_CBE 94.9145%-109 - C1 -1AHX 3.9 AAT_ECOLI
69 PsiBlast_CBE 94.8047%-108 - C1 -1CZE 4.7 AAT_ECOLI
33 PsiBlast_CBE 94.7846%-110 - C1 -1ART 9.7 AAT_ECOLI
35 PsiBlast_CBE 94.7546%-110 - C1 -1ASG 3.6 AAT_ECOLI
15 PsiBlast_PDB 94.6246%-110 - C1 -1X2A 10.6 AAT_ECOLI
50 PsiBlast_CBE 94.6046%-110 - C1 -2D63 4.2 AAT_ECOLI
7 PsiBlast_PDB 94.4346%-107 - C1 -1ASN - AAT_ECOLI -
53 PsiBlast_CBE 94.2946%-109 - C1 -1SPA 7.3 AAT_ECOLI
20 PsiBlast_PDB 94.2646%-110 - C1 -1ARS 5.1 AAT_ECOLI
65 PsiBlast_CBE 94.2246%-108 - C1 -2D5Y 4.4 AAT_ECOLI
38 PsiBlast_CBE 94.1646%-109 - C1 -1IX6 5.5 AAT_ECOLI
99 PsiBlast_CBE 94.1545%-111 - C1 -1TOI 4.7 AAT_ECOLI
94 PsiBlast_CBE 94.1545%-109 - C1 -1TOG 4.2 AAT_ECOLI
42 PsiBlast_CBE 94.1446%-110 - C1 -1AIC 7.0 AAT_ECOLI
23 PsiBlast_CBE 94.1346%-110 - C1 -3PA9 7.8 ?
83 PsiBlast_CBE 94.1145%-109 - C1 -1AHY 3.8 AAT_ECOLI
64 PsiBlast_CBE 94.0646%-111 - C1 -1G4V 5.4 AAT_ECOLI
47 PsiBlast_CBE 94.0546%-113 - C1 -4DBC 10.2 AAT_ECOLI
73 PsiBlast_CBE 94.0146%-108 - C1 -1G4X 3.4 AAT_ECOLI
43 PsiBlast_CBE 94.0146%-108 - C1 -1AIB 6.3 AAT_ECOLI
60 PsiBlast_CBE 93.9746%-110 - C1 -1B4X 4.3 AAT_ECOLI
29 PsiBlast_CBE 93.9646%-109 - C1 -1ASL 6.8 AAT_ECOLI
85 PsiBlast_CBE 93.8945%-109 - C1 -1AHX 3.6 AAT_ECOLI
17 PsiBlast_PDB 93.8646%-109 - C1 -1AMQ 6.9 AAT_ECOLI
12 PsiBlast_PDB 93.8446%-107 - C1 -1CQ8 9.7 AAT_ECOLI
72 PsiBlast_CBE 93.8046%-108 - C1 -1G7W 4.4 AAT_ECOLI
14 PsiBlast_PDB 93.7846%-108 - C1 -1X29 9.7 AAT_ECOLI
68 PsiBlast_CBE 93.7546%-111 - C1 -1ARI 3.5 AAT_ECOLI
98 PsiBlast_CBE 93.7245%-111 - C1 -1TOJ 4.2 AAT_ECOLI
82 PsiBlast_CBE 93.7046%-110 - C1 -2D64 4.5 AAT_ECOLI
19 PsiBlast_PDB 93.6646%-108 - C1 -1AMS 6.8 AAT_ECOLI
97 PsiBlast_CBE 93.6245%-110 - C1 -1TOK 3.0 AAT_ECOLI
30 PsiBlast_CBE 93.6246%-110 - C1 -1ASE 3.4 AAT_ECOLI
28 PsiBlast_CBE 93.5846%-111 - C1 -1ASM 3.7 AAT_ECOLI
93 PsiBlast_CBE 93.5746%-108 - C1 -1G7X 4.1 AAT_ECOLI
26 PsiBlast_CBE 93.4946%-112 - C1 -1X28 9.8 AAT_ECOLI
84 PsiBlast_CBE 93.4345%-108 - C1 -1AHY 3.5 AAT_ECOLI
24 PsiBlast_CBE 93.4346%-108 - C1 -1X2A 10.4 AAT_ECOLI
96 PsiBlast_CBE 93.3545%-112 - C1 -1TOK 3.2 AAT_ECOLI
87 PsiBlast_CBE 93.3545%-110 - C1 -1AHG 7.7 AAT_ECOLI
9 PsiBlast_PDB 93.2546%-110 - C1 -1C9C 8.5 AAT_ECOLI
75 PsiBlast_CBE 93.2146%-108 - C1 -1ARH 8.4 AAT_ECOLI
74 PsiBlast_CBE 93.2046%-108 - C1 -1ARH 8.2 AAT_ECOLI
10 PsiBlast_PDB 93.1346%-107 - C1 -1CQ6 7.3 AAT_ECOLI
46 PsiBlast_CBE 93.1246%-106 - C1 -1AIA 6.6 AAT_ECOLI
59 PsiBlast_CBE 93.0046%-109 - C1 -5EAA 4.5 AAT_ECOLI
57 PsiBlast_CBE 92.9646%-108 - C1 -2D7Z 5.1 AAT_ECOLI
11 PsiBlast_PDB 92.9646%-111 - C1 -1CQ7 9.5 AAT_ECOLI
16 PsiBlast_PDB 92.9446%-112 - C1 -1AAW 4.2 AAT_ECOLI
92 PsiBlast_CBE 92.9145%-106 - C1 -1AHE 4.2 AAT_ECOLI
18 PsiBlast_PDB 92.9146%-111 - C1 -1AMR 6.6 AAT_ECOLI
22 PsiBlast_CBE 92.7646%-111 - C1 -3PAA 7.8 ?
5 PsiBlast_PDB 92.7246%-109 - C1 -1ASL 8.1 AAT_ECOLI
1 PsiBlast_PDB 92.6547%-112 - C1 -4F5L 2.2 AAT_ECOLI
31 PsiBlast_CBE 92.6246%-112 - C1 -1ASD 4.2 AAT_ECOLI
55 PsiBlast_CBE 92.6146%-111 - C1 -1ASB 3.9 AAT_ECOLI
6 PsiBlast_PDB 92.6146%-108 - C1 -1ASM 4.8 AAT_ECOLI
58 PsiBlast_CBE 92.5546%-109 - C1 -2D66 4.8 AAT_ECOLI
51 PsiBlast_CBE 92.4846%-109 - C1 -2D61 4.2 AAT_ECOLI
81 PsiBlast_CBE 92.4246%-110 - C1 -2D65 4.6 AAT_ECOLI
91 PsiBlast_CBE 92.3045%-107 - C1 -1AHE 4.2 AAT_ECOLI
79 PsiBlast_CBE 92.2946%-108 - C1 -3ZZK 6.5 AAT_ECOLI
49 PsiBlast_CBE 92.2446%-108 - C1 -2D7Y 4.3 AAT_ECOLI
67 PsiBlast_CBE 92.2246%-110 - C1 -1ARI 3.3 AAT_ECOLI
89 PsiBlast_CBE 92.0945%-110 - C1 -1AHF 4.4 AAT_ECOLI
44 PsiBlast_CBE 92.0946%-108 - C1 -1AIB 6.0 AAT_ECOLI
66 PsiBlast_CBE 92.0646%-109 - C1 -1IX8 4.2 AAT_ECOLI
90 PsiBlast_CBE 92.0545%-107 - C1 -1AHF 3.9 AAT_ECOLI
80 PsiBlast_CBE 92.0446%-108 - C1 -3ZZJ 4.0 AAT_ECOLI
32 PsiBlast_CBE 92.0246%-108 - C1 -1ASA 4.2 AAT_ECOLI
78 PsiBlast_CBE 92.0046%-110 - C1 -4A00 7.6 AAT_ECOLI
88 PsiBlast_CBE 91.7445%-109 - C1 -1AHG 9.8 AAT_ECOLI
27 PsiBlast_CBE 91.6646%-108 - C1 -1ASN 4.3 AAT_ECOLI
54 PsiBlast_CBE 91.3846%-108 - C1 -1ASC 6.6 AAT_ECOLI
95 PsiBlast_CBE 91.2845%-110 - C1 -1TOG 4.7 AAT_ECOLI
41 PsiBlast_CBE 90.9646%-107 - C1 -1AIC 6.5 AAT_ECOLI
45 PsiBlast_CBE 90.7246%-105 - C1 -1AIA 6.4 AAT_ECOLI
77 PsiBlast_CBE 90.5446%-106 - C1 -4F5M 2.7 AAT_ECOLI
36 PsiBlast_CBE 90.3246%-109 - C1 -1ASF 4.4 AAT_ECOLI
56 PsiBlast_CBE 87.7046%-107 - C1 -3AAT 3.3 AAT_ECOLI
113 HHSearch 86.4338%-101 - C1 -1AJS 9.3 AATC_PIG
108 HHSearch 85.2945%-102 - C1 -2AY1 5.0 TYRB_PARDE
48 PsiBlast_CBE 80.1746% -97 - C1 -2AAT 4.5 AAT_ECOLI
52 PsiBlast_CBE 80.0046%-101 - C1 -1AAM 3.1 AAT_ECOLI