Study : PA0923 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C3_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C3_S1
Complex: NACID_C_4(4Q44) / Model_8(4Q44/A) = [3.3] Download--MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF
Complex: NACID_H_6(4Q44) / Model_25(4Q44/F) = [3.4] Download--MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF
Complex: DCP_B_7(4IRK) / Model_7(4IRK/B) = [3.5] Download1119.2015.81MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF
Complex: 1FZ_F_7(4Q45) / Model_9(4Q45/F) = [3.7] Download1341.9216.74MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF
Complex: 0KX_A_7(4Q43) / Model_3(4Q43/A) = [3.9] Download1082.4320.52MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF
Consensus
[pKd Mean = 3.56]
-1181
(s=114)
17
(s=2)
MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF