@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA0923: (2016-01-25 )
MRKIIHIDCDCFYAALEMRDDPSLRGKALAVGGSPDKRGVVATCSYEARAYGVRSAMAMRTALKLCPDLLVVRPRFDVYRAVSKQIHAIFRDYTDLIEPLSLDEAYLDVSASPHFAGSATRIAQDIRRRVAEELHITVSAGVAPNKFLAKIASDWRKPDGLFVITPEQVDGFVAELPVAKLHGVGKVTAERLARMGIRTCADLRQGSKLSLVREFGSFGERLWGLAHGIDERPVEVDSRRQSVSVECTFDRDLPDLAACLEELPTLLEELDGRLQRLDGSYRPDKPFVKLKFHDFTQTTVEQSGAGRDLESYRQLLGQAFARGNRPVRLIGVGVRLLDLQGAHEQLRLF

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0KX_A_7(4Q43)
DPO4_ECOLI
[Raw transfer]




XG4_F_7(4IR9)
DPO4_ECOLI
[Raw transfer]




DZ4_F_7(4IRD)
DPO4_ECOLI
[Raw transfer]




1FZ_F_7(4IR1)
DPO4_ECOLI
[Raw transfer]




DCP_B_7(4IRK)
DPO4_ECOLI
[Raw transfer]




1FZ_F_7(4Q45)
DPO4_ECOLI
[Raw transfer]




DCP_A_9(4IRK)
DPO4_ECOLI
[Raw transfer]




TTP_A_4(3OSN)
POLI_HUMAN
[Raw transfer]




DZ4_A_10(4IRD)
DPO4_ECOLI
[Raw transfer]




0KX_F_7(4IRC)
DPO4_ECOLI
[Raw transfer]




TTP_A_9(2OH2)
POLK_HUMAN
[Raw transfer]




DGT_A_7(2W7O)
POLK_HUMAN
[Raw transfer]




NACID_H_6(4Q44)
DPO4_ECOLI
[Raw transfer]

-

NACID_G_3(4IR1)
DPO4_ECOLI
[Raw transfer]

-

NACID_B_5(4IR1)
DPO4_ECOLI
[Raw transfer]

-

NACID_C_2(4IRK)
DPO4_ECOLI
[Raw transfer]

-

NACID_G_1(4IRC)
DPO4_ECOLI
[Raw transfer]

-

NACID_F_5(4IRK)
DPO4_ECOLI
[Raw transfer]

-

NACID_B_3(4IRC)
DPO4_ECOLI
[Raw transfer]

-

NACID_B_5(4Q45)
DPO4_ECOLI
[Raw transfer]

-

NACID_B_3(4IRD)
DPO4_ECOLI
[Raw transfer]

-

CHAIN_W_4(4R8U)
DPO4_ECOLI
[Raw transfer]

-

NACID_B_2(4IR9)
DPO4_ECOLI
[Raw transfer]

-

NACID_B_3(4Q43)
DPO4_ECOLI
[Raw transfer]

-

NACID_G_3(4Q45)
DPO4_ECOLI
[Raw transfer]

-

CHAIN_C_5(4R8U)
?
[Raw transfer]

-

NACID_G_5(4Q43)
DPO4_ECOLI
[Raw transfer]

-

NACID_G_1(4IRD)
DPO4_ECOLI
[Raw transfer]

-

NACID_C_4(4Q44)
DPO4_ECOLI
[Raw transfer]

-

26 PsiBlast_CBE 95.5449%-123 - C3 -4IRK 6.2 DPO4_ECOLI
29 PsiBlast_CBE 95.1749%-127 - C3 -4R8U 6.5 ?
21 PsiBlast_CBE 94.8749%-119 - C3 -4Q43 5.0 DPO4_ECOLI
9 PsiBlast_PDB 94.7749%-120 - C3 -4Q45 5.1 DPO4_ECOLI
4 PsiBlast_PDB 94.7749%-124 - C3 -4R8U 5.2 DPO4_ECOLI
1 PsiBlast_PDB 94.7249%-121 - C3 -4IR1 5.2 DPO4_ECOLI
5 PsiBlast_PDB 94.6749%-120 - C3 -4IRC 9.9 DPO4_ECOLI
2 PsiBlast_PDB 94.6549%-121 - C3 -4IR9 4.5 DPO4_ECOLI
8 PsiBlast_PDB 94.5749%-121 - C3 -4Q44 3.3 DPO4_ECOLI
3 PsiBlast_PDB 94.1649%-123 - C3 -4Q43 9.3 DPO4_ECOLI
6 PsiBlast_PDB 94.1049%-116 - C3 -4IRD 5.7 DPO4_ECOLI
24 PsiBlast_CBE 93.9449%-121 - C3 -4Q45 6.9 DPO4_ECOLI
7 PsiBlast_PDB 93.9149%-122 - C3 -4IRK 6.0 DPO4_ECOLI
27 PsiBlast_CBE 93.4949%-122 - C3 -4IRD 5.3 DPO4_ECOLI
22 PsiBlast_CBE 93.3649%-120 - C3 -4IR9 5.5 DPO4_ECOLI
23 PsiBlast_CBE 93.2849%-120 - C3 -4IR1 6.2 DPO4_ECOLI
25 PsiBlast_CBE 93.1049%-119 - C3 -4Q44 3.4 DPO4_ECOLI
28 PsiBlast_CBE 92.9849%-118 - C3 -4IRC 10.8 DPO4_ECOLI
111 HHSearch 79.0129%-105 - C3 -3GQC - REV1_HUMAN -
115 HHSearch 78.9029%-114 - C3 -3OSN 4.2 POLI_HUMAN
104 Fugue 78.7734%-111 - C3 -2W7O 4.6 POLK_HUMAN
101 Fugue 76.0934%-103 - C3 -2OH2 4.8 POLK_HUMAN