@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1070: (2016-01-26 )
MLSFDKVSTYYGKIQALHDVSVEVKKGEIVTLIGANGAGKSTLLMTLCGSPQAASGSIRYEGEELVGLPSSTIMRKSIAVVPEGRRVFSRLTVEENLAMGGFFTDKDDYQVQMDKVLELFPRLKERYEQRAGTMSGGEQQMLAIGRALMSKPKLLLLDEPSLGLAPIIIQQIFEIIEQLRREGVTVFLVEQNANQALKLADRAYVLENGRIVMHDTGAALLTNPKVRDAYLGG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_2(1JI0)
?
[Raw transfer]




ADP_A_8(1G9X)
LIVG_METJA
[Raw transfer]




1 PsiBlast_PDB 96.3951%-130 - C1 -1JI0 5.1 ?
52 HHSearch 94.5651%-128 - C1 -1JI0 - ? -
24 PsiBlast_CBE 79.6731%-108 - C1 -4WBS - ? -
9 PsiBlast_PDB 78.1931%-108 - C1 -4WBS - ? -
23 PsiBlast_CBE 77.9632%-111 - C1 -4P33 - LPTB_ECOLI -
47 HHSearch 77.9031%-112 * C1 *3TUI - METN_ECOLI -
7 PsiBlast_PDB 77.6433%-117 - C1 -4P32 - LPTB_ECOLI -
8 PsiBlast_PDB 77.3132%-113 - C1 -4P33 - LPTB_ECOLI -
21 PsiBlast_CBE 76.9833%-120 - C1 -4QC2 - ? -
22 PsiBlast_CBE 76.8833%-120 - C1 -4P32 - LPTB_ECOLI -
59 HHSearch 76.7431%-118 - C1 -1G6H - LIVG_METJA -
2 PsiBlast_PDB 76.2030%-120 - C1 -1G6H - LIVG_METJA -
5 PsiBlast_PDB 75.7133%-116 - C1 -4QC2 - ? -
65 Fugue 75.6730%-116 - C1 -3TUZ - METN_ECOLI -
12 PsiBlast_PDB 75.0833%-111 - C1 -3TUZ - METN_ECOLI -
30 PsiBlast_CBE 75.0433%-110 - C1 -3TUI - METN_ECOLI -
29 PsiBlast_CBE 74.5433%-105 - C1 -3TUI - METN_ECOLI -
4 PsiBlast_PDB 74.1230%-113 - C1 -1GAJ - LIVG_METJA -
32 PsiBlast_CBE 74.1133%-106 - C1 -3FVQ - FBPC_NEIG1 -
33 PsiBlast_CBE 73.9233%-104 - C1 -3FVQ - FBPC_NEIG1 -
3 PsiBlast_PDB 71.7330%-112 - C1 -1G9X 5.2 LIVG_METJA