@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1256: (2016-01-27 )
MIEINDVHKAYGQFEVVKGVDLRVDKGEVLSIIGGSGSGKSTLLMCINGLEPIQRGSIRVDGIDVHARGTDLNRLRRKIGIVFQQWNAFPHLTVLENVMLAPRKVLGKSRAEAEAMALKQLTHVGLGDKLKVFPQRLSGGQQQRMAIARALAMSPDYMLFDEATSALDPQLVGEVLDTMRLLAEEGMTMVLVTHEIRFARDVSDRVAFFRNGLVHEIGPPDQVIGNPQRPETVEFLRSVL

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ATP_A_5(1B0U)
HISP_SALTY
[Raw transfer]




ADP_A_5(2OLJ)
?
[Raw transfer]




12 PsiBlast_PDB 95.5154%-120 - C1 -4U00 - ? -
133 HHSearch 95.2555%-121 - C1 -1B0U 6.0 HISP_SALTY
35 PsiBlast_CBE 94.5854%-119 - C1 -4U02 - ? -
34 PsiBlast_CBE 94.5854%-116 - C1 -4U02 - ? -
13 PsiBlast_PDB 94.0854%-117 - C1 -4U02 - ? -
11 PsiBlast_PDB 93.5852%-118 - C1 -3C4J - ? -
31 PsiBlast_CBE 93.3252%-121 - C1 -2OLK - ? -
33 PsiBlast_CBE 92.9654%-117 - C1 -4U02 - ? -
23 PsiBlast_CBE 92.8252%-123 - C1 -3C41 - ? -
14 PsiBlast_PDB 92.6852%-120 - C1 -1B0U - HISP_SALTY -
24 PsiBlast_CBE 92.6152%-124 - C1 -3C4J - ? -
29 PsiBlast_CBE 92.2652%-117 - C1 -2OLK - ? -
2 PsiBlast_PDB 92.2154%-121 - C1 -4YMT - ? -
3 PsiBlast_PDB 92.1954%-119 - C1 -4YMU - ? -
132 HHSearch 92.1453%-120 - C1 -2OLJ 5.9 ?
9 PsiBlast_PDB 91.7152%-124 - C1 -2OUK - ? -
7 PsiBlast_PDB 91.7152%-121 - C1 -2OLJ - ? -
8 PsiBlast_PDB 91.4952%-121 - C1 -2OLK - ? -
21 PsiBlast_CBE 91.3954%-120 - C1 -4YMV - ? -
22 PsiBlast_CBE 91.2954%-122 - C1 -4YMU - ? -
116 Fugue 85.0855%-127 - C1 -1B0U 6.1 HISP_SALTY