@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1377: (2016-01-28 )
MTAESPTIRLERYSERHVEGLTALYNDPAVARQVLQMPYQSVEQRRKRLHDSADDDRLLILVALHQGDVIGSASLEQHPRIRRSHSGSIGMGVAVAWQGKGVGSRLLGELLDIADNWMNLRRVELTVYTDNAPALALYRKFGFETEGEMRDYAVRDGRFVDVYSMARLRRVEGRVGE

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

GOL_C_12(2VI7)
?
[Raw transfer]




GOL_B_8(2VI7)
?
[Raw transfer]




GOL_C_13(2VI7)
?
[Raw transfer]




ACO_D_4(1WWZ)
?
[Raw transfer]




67 HHSearch 96.73100%-117 - C1 -2VI7 2.9 ?
1 PsiBlast_PDB 96.69100%-117 - C1 -2VI7 - ? -
21 PsiBlast_CBE 96.58100%-111 - C1 -2VI7 2.3 ?
22 PsiBlast_CBE 95.84100%-115 - C1 -2VI7 2.1 ?
74 HHSearch 69.3233% -89 - C1 -2GE3 - ? -
71 HHSearch 67.4520% -89 - C1 -3WR7 - ? -
11 PsiBlast_PDB 65.3129% -86 - C1 -4MI4 - ATDA_VIBCH -
10 PsiBlast_PDB 65.1529% -83 - C1 -4MHD - ATDA_VIBCH -
7 PsiBlast_PDB 65.1229% -85 * C1 *4MJ8 - ATDA_VIBCH -
9 PsiBlast_PDB 63.6829% -88 - C1 -4R87 - ATDA_VIBCH -
6 PsiBlast_PDB 63.5729% -79 - C1 -4JLY - ATDA_VIBCH -
8 PsiBlast_PDB 62.3729% -80 - C1 -4R57 - ATDA_VIBCH -
12 PsiBlast_PDB 62.3029% -85 - C1 -4NCZ - ATDA_VIBCH -
77 HHSearch 61.9923% -84 - C1 -1S7K - ? -
5 PsiBlast_PDB 61.9729% -71 - C1 -4JJX - ATDA_VIBCH -
70 HHSearch 61.6221% -99 - C1 -3TTH - ? -
78 HHSearch 61.4328% -83 - C1 -2I79 - ? -
76 HHSearch 61.3827% -84 - C1 -3OWC - ATSE2_PSEAE -
95 Fugue 60.7918% -87 - C1 -4RI1 - PSEH_HELPY -
18 PsiBlast_PDB 60.3125%-101 - C1 -3TTH - ? -