Study : PA1686 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C6_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C6_S1
Complex: NACID_F_6(3D4V) / Model_23(3D4V/B) = [3.1] Download--MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG
Complex: NACID_E_5(3CWU) / Model_13(3CWU/A) = [3.1] Download--MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG
Complex: NACID_H_8(3CVT) / Model_40(3CVT/C) = [3.2] Download--MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG
Complex: NACID_E_5(3CVT) / Model_8(3CVT/A) = [3.4] Download--MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG
Complex: NACID_G_7(3CVS) / Model_42(3CVS/D) = [3.4] Download--MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG
Consensus
[pKd Mean = 3.24]
-0
(s=0)
0
(s=0)
MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG