@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1686: (2016-01-31 )
MSQPTSPLVLHLPYQSPWEWRQFHQHFALRLLAGVESLGDDHYARSFRANGRPAWFEVRPLAERQVLALSLSPSAHALAAELEARVRRMFDLDSDPAAIARHFAGDPLLGPLVAANPGLRLPVAFDPFEQAVRAIVGQQVTVKAAVTITGRLIQRLGEPLEDLGYDGISHLFPTPAALAQANLDGIGMPGKRVQTLQRFAAAIASGELSLDLADGPEALVERLCALPGIGPWTAEYIALRAMGEADAFPAADLGLLKSTVWGPQGIDARSLKARAEAWRPWRAYAAIHLWHHYAAGG

Atome Classification :

(42 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

7HP_C_3(1PVS)
3MG2_ECOLI
[Raw transfer]




7HP_D_4(1PVS)
3MG2_ECOLI
[Raw transfer]




NACID_H_8(3CW7)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3CWA)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3CVT)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3CWS)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3D4V)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3CVS)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3CWT)
3MG2_ECOLI
[Raw transfer]

-

NACID_H_8(3CWU)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CWA)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CWA)
3MG2_ECOLI
[Raw transfer]

-

NACID_B_2(3OH6)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3D4V)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CVS)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CW7)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CVS)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CWA)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CWS)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CWS)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CWU)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3D4V)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CVT)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3D4V)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CVT)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CWU)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CW7)
3MG2_ECOLI
[Raw transfer]

-

NACID_G_7(3CWT)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_5(3CWT)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CW7)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CWT)
3MG2_ECOLI
[Raw transfer]

-

NACID_B_2(3OGD)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CWS)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CWU)
3MG2_ECOLI
[Raw transfer]

-

NACID_C_1(1DIZ)
3MG2_ECOLI
[Raw transfer]

-

NACID_E_3(1DIZ)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CVS)
3MG2_ECOLI
[Raw transfer]

-

NACID_F_6(3CVT)
3MG2_ECOLI
[Raw transfer]

-

1 PsiBlast_PDB 96.4037%-108 - C6 -3OGD 2.2 3MG2_ECOLI
46 PsiBlast_CBE 96.1437%-107 - C6 -1MPG - 3MG2_ECOLI -
4 PsiBlast_PDB 95.5037%-106 - C6 -1MPG - 3MG2_ECOLI -
29 PsiBlast_CBE 95.2537%-111 - C6 -3CWT 2.8 3MG2_ECOLI
34 PsiBlast_CBE 95.2337%-108 - C6 -3CWA 4.1 3MG2_ECOLI
25 PsiBlast_CBE 95.0137%-106 - C6 -3CWU 3.5 3MG2_ECOLI
43 PsiBlast_CBE 94.9337%-107 - C6 -3CVS 3.9 3MG2_ECOLI
8 PsiBlast_PDB 94.9337%-109 - C6 -3CVT 3.4 3MG2_ECOLI
5 PsiBlast_PDB 94.9337%-108 - C6 -1DIZ 6.3 3MG2_ECOLI
33 PsiBlast_CBE 94.8337%-108 - C6 -3CWA 3.9 3MG2_ECOLI
93 HHSearch 94.7337%-109 - C6 -1MPG - 3MG2_ECOLI -
3 PsiBlast_PDB 94.6937%-110 - C6 -3OH9 - 3MG2_ECOLI -
45 PsiBlast_CBE 94.6837%-107 - C6 -1PVS 3.5 3MG2_ECOLI
23 PsiBlast_CBE 94.6637%-108 - C6 -3D4V 3.1 3MG2_ECOLI
14 PsiBlast_PDB 94.4337%-106 - C6 -3D4V 5.1 3MG2_ECOLI
42 PsiBlast_CBE 94.1837%-106 - C6 -3CVS 3.4 3MG2_ECOLI
2 PsiBlast_PDB 94.1537%-105 - C6 -3OH6 3.9 3MG2_ECOLI
22 PsiBlast_CBE 94.1337%-109 - C6 -3D4V 2.2 3MG2_ECOLI
27 PsiBlast_CBE 94.0337%-109 - C6 -3CWT 5.4 3MG2_ECOLI
26 PsiBlast_CBE 94.0337%-110 - C6 -3CWU 3.7 3MG2_ECOLI
28 PsiBlast_CBE 93.9237%-105 - C6 -3CWT 3.5 3MG2_ECOLI
38 PsiBlast_CBE 93.8537%-109 - C6 -3CW7 4.9 3MG2_ECOLI
6 PsiBlast_PDB 93.8137%-110 - C6 -1PVS 3.7 3MG2_ECOLI
30 PsiBlast_CBE 93.7937%-107 - C6 -3CWS 5.4 3MG2_ECOLI
7 PsiBlast_PDB 93.7837%-108 - C6 -3CVS 5.2 3MG2_ECOLI
31 PsiBlast_CBE 93.7737%-108 - C6 -3CWS 4.3 3MG2_ECOLI
32 PsiBlast_CBE 93.7637%-110 - C6 -3CWS 2.5 3MG2_ECOLI
47 PsiBlast_CBE 93.7537%-109 - C6 -1DIZ 5.4 3MG2_ECOLI
10 PsiBlast_PDB 93.7337%-106 - C6 -3CWA 4.7 3MG2_ECOLI
12 PsiBlast_PDB 93.7037%-109 - C6 -3CWT 4.0 3MG2_ECOLI
37 PsiBlast_CBE 93.6837%-110 - C6 -3CW7 4.1 3MG2_ECOLI
36 PsiBlast_CBE 93.6837%-108 - C6 -3CW7 4.5 3MG2_ECOLI
21 PsiBlast_CBE 93.6137%-107 - C6 -3D4V 3.7 3MG2_ECOLI
13 PsiBlast_PDB 93.6037%-105 - C6 -3CWU 3.1 3MG2_ECOLI
39 PsiBlast_CBE 93.5137%-108 - C6 -3CVT 3.0 3MG2_ECOLI
35 PsiBlast_CBE 93.3337%-107 - C6 -3CWA 5.0 3MG2_ECOLI
40 PsiBlast_CBE 93.1437%-105 - C6 -3CVT 3.2 3MG2_ECOLI
41 PsiBlast_CBE 93.0737%-109 - C6 -3CVT 4.7 3MG2_ECOLI
9 PsiBlast_PDB 93.0337%-110 - C6 -3CW7 3.7 3MG2_ECOLI
24 PsiBlast_CBE 92.9537%-107 - C6 -3CWU 3.4 3MG2_ECOLI
44 PsiBlast_CBE 92.6737%-111 - C6 -3CVS 2.4 3MG2_ECOLI
11 PsiBlast_PDB 92.5037%-107 - C6 -3CWS 3.7 3MG2_ECOLI