@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1707: (2016-01-31 )
MNQPTPSDTDQQQALEAFLRDGGTLAMLRGLSEDTLEQLYALGFNQYQAGKWDDAQKIFQALCMLDHYDARYFLGLGACRQSLGLYEQALQSYSYGALMDINEPRFPFHAAECHLQLGDLDGAESGFYSARALAAAQPAHEALAARAGAMLEAVTARKDRAYESDNA

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

BU3_B_8(4AM9)
?
[Raw transfer]




CHAIN_D_4(4JL0)
?
[Raw transfer]

-

CHAIN_C_3(2XCB)
?
[Raw transfer]

-

CHAIN_C_3(4JL0)
?
[Raw transfer]

-

CHAIN_B_2(4AM9)
?
[Raw transfer]

-

3 PsiBlast_PDB 97.65100%-100 - C2 -4JL0 7.5 ?
1 PsiBlast_PDB 96.86100%-101 - C2 -2XCB 7.2 ?
22 PsiBlast_CBE 95.79100%-107 - C2 -2XCB - ? -
2 PsiBlast_PDB 95.71100%-108 - C2 -2XCC - ? -
21 PsiBlast_CBE 90.42100% -92 - C2 -4JL0 6.8 ?
4 PsiBlast_PDB 83.4661% -94 - C2 -4AM9 6.0 ?
5 PsiBlast_PDB 82.2360%-105 - C2 -2VGX - ? -
6 PsiBlast_PDB 80.1958%-107 - C2 -2VGY - ? -
42 HHSearch 79.5997% -97 - C2 -2XCB - ? -
41 HHSearch 77.9861%-105 - C2 -2VGX - ? -
7 PsiBlast_PDB 67.8625%-102 - C2 -3KS2 - IPGC_SHIFL -
11 PsiBlast_PDB 66.6222% -85 - C2 -4NRH - ? -
8 PsiBlast_PDB 66.3125%-100 - C2 -3GYZ - IPGC_SHIFL -
9 PsiBlast_PDB 65.9025% -99 - C2 -3GZ1 - IPGC_SHIFL -
10 PsiBlast_PDB 65.2225%-101 - C2 -3GZ2 - IPGC_SHIFL -
54 Fugue 60.5415% -67 - C2 -4UZY - ? -
36 HHSearch 55.7318% -53 - C2 -2Q7F - YRRB_BACSU -
19 PsiBlast_PDB 54.7523% -68 - C2 -3ASG - ? -
12 PsiBlast_PDB 54.1226% -71 - C2 -1NA0 - ? -
20 PsiBlast_PDB 52.7623% -68 - C2 -3ASH - ? -