@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1757: (2016-02-01 )
MEIACLDLEGVLVPEIWIAFAEKTGIDALKATTRDIPDYDVLMKQRLRILDEHGLKLGDIQEVIATLKPLEGAVEFVDWLRERFQVVILSDTFYEFSQPLMRQLGFPTLLCHKLEIDDSDRVVGYQLRQKDPKRQSVIAFKSLYYRVIAAGDSYNDTTMLSEAHAGILFHAPENVIREFPQFPAVHTYEDLKREFLKASSRSLSL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

EDO_B_11(1RKV)
THRH_PSEAE
[Raw transfer]




EDO_A_10(1RKU)
THRH_PSEAE
[Raw transfer]




21 PsiBlast_CBE 99.97100%-143 - C2 -1RKV 3.2 THRH_PSEAE
22 PsiBlast_CBE 99.42100%-139 - C2 -1RKU - THRH_PSEAE -
43 Fugue 97.35100%-138 - C2 -1RKU - THRH_PSEAE -
23 HHSearch 97.35100%-138 - C2 -1RKU 2.8 THRH_PSEAE
1 PsiBlast_PDB 97.35100%-138 - C2 -1RKU - THRH_PSEAE -
2 PsiBlast_PDB 96.98100%-136 - C2 -1RKV - THRH_PSEAE -
4 PsiBlast_PDB 61.2628%-127 - C2 -4AP9 - ? -
46 Fugue 60.4326% -96 - C2 -3P96 - SERB_MYCA1 -
44 Fugue 59.7320%-100 - C2 -1F5S - SERB_METJA -
25 HHSearch 59.7018%-102 - C2 -1L7M - SERB_METJA -
26 HHSearch 59.1718%-120 - C2 -1NNL - SERB_HUMAN -
48 Fugue 59.0718%-105 - C2 -4EZE - ? -
28 HHSearch 58.2423%-102 * C2 *3P96 - SERB_MYCA1 -
3 PsiBlast_PDB 57.3029%-107 - C2 -4B6J - ? -
27 HHSearch 54.9723%-111 - C2 -3M1Y - ? -
24 HHSearch 54.9221% -97 - C2 -3N28 - ? -
5 PsiBlast_PDB 54.6727% -81 - C2 -3P96 - SERB_MYCA1 -
30 HHSearch 53.1217% -94 - C2 -3M9L - ? -
49 Fugue 50.5321% -87 - C2 -3N28 - ? -
45 Fugue 39.388% -78 - C2 -1Y8A - ? -