@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1806: (2016-02-01 )
MGFLTGKRALIVGVASKLSIASGIAAAMHREGAELAFTYQNDKLRGRVEEFASGWGSRPELCFPCDVADDSQIEAVFAALGKHWDGLDIIVHSVGFAPGDQLDGDFTAVTTREGFRIAHDISAYSFIALAKAGREMMKGRNGSLLTLSYLGAERTMPNYNVMGMAKASLEAGVRYLAGSLGAEGTRVNAVSAGPIRTLAASGIKSFRKMLAANERQTPLRRNVTIEEVGNAGAFLCSDLASGISGEILYVDGGFNTTAMGPLDDD

Atome Classification :

(75 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0WE_A_4(4JQC)
FABI_ECOLI
[Raw transfer]




NAI_A_4(4CV3)
?
[Raw transfer]




NAD_D_8(1DFI)
FABI_ECOLI
[Raw transfer]




IDN_M_13(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_A_3(4D46)
?
[Raw transfer]




NAD_D_11(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_C_9(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_D_11(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_B_5(4M89)
?
[Raw transfer]




NAD_A_3(4M89)
?
[Raw transfer]




NAD_B_7(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_A_3(3NRC)
?
[Raw transfer]




NAI_B_5(4CV2)
?
[Raw transfer]




NAD_C_9(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_B_7(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1QG6)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJF)
FABI_ECOLI
[Raw transfer]




NAD_B_4(4M87)
?
[Raw transfer]




NAD_B_7(2PD3)
FABI_HELPY
[Raw transfer]




NAD_E_5(1LX6)
FABI_ECOLI
[Raw transfer]




AYM_I_9(1LXC)
FABI_ECOLI
[Raw transfer]




AE6_A_3(4JX8)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1I30)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_A_5(4NR0)
FABI_PSEAE
[Raw transfer]




NAD_A_5(1DFH)
FABI_ECOLI
[Raw transfer]




NAD_C_7(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3NRC)
?
[Raw transfer]




NAI_A_3(4CV2)
?
[Raw transfer]




NDP_D_8(3OJF)
FABI_BACCR
[Raw transfer]




NAD_B_5(4D46)
?
[Raw transfer]




IDN_K_11(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_B_9(1DFH)
FABI_ECOLI
[Raw transfer]




AYM_K_11(1LXC)
FABI_ECOLI
[Raw transfer]




NAI_B_6(4CV3)
?
[Raw transfer]




NAD_A_2(3OIG)
FABI_BACSU
[Raw transfer]




NAD_G_7(1I30)
FABI_ECOLI
[Raw transfer]




NAD_D_7(3OIF)
FABI_BACSU
[Raw transfer]




NAD_C_9(2PD3)
FABI_HELPY
[Raw transfer]




NAD_B_5(1C14)
FABI_ECOLI
[Raw transfer]




NAD_A_3(1D8A)
FABI_ECOLI
[Raw transfer]




NAD_D_11(2PD3)
FABI_HELPY
[Raw transfer]




NAD_A_3(4M87)
?
[Raw transfer]




NAD_I_9(1LX6)
FABI_ECOLI
[Raw transfer]




NAD_A_3(1C14)
FABI_ECOLI
[Raw transfer]




NAD_B_4(1D8A)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_G_7(1MFP)
FABI_ECOLI
[Raw transfer]




NAD_B_6(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_3(3PJF)
FABI_ECOLI
[Raw transfer]




NAD_I_9(1MFP)
FABI_ECOLI
[Raw transfer]




NDP_C_12(3OJF)
FABI_BACCR
[Raw transfer]




NAD_D_8(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_3(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_I_9(1I2Z)
FABI_ECOLI
[Raw transfer]




NAD_A_5(2PD4)
FABI_HELPY
[Raw transfer]




NAD_C_7(2PD4)
FABI_HELPY
[Raw transfer]




NAD_A_3(4J1N)
?
[Raw transfer]




NAD_D_5(2JJY)
?
[Raw transfer]




NAD_A_5(2PD3)
FABI_HELPY
[Raw transfer]




NAD_B_6(4J1N)
?
[Raw transfer]




1S5_A_3(4BKU)
?
[Raw transfer]




NAD_A_3(3PJD)
FABI_ECOLI
[Raw transfer]




NAD_B_9(1DFG)
FABI_ECOLI
[Raw transfer]




NAD_A_5(3OIF)
FABI_BACSU
[Raw transfer]




NAD_B_5(3PJD)
FABI_ECOLI
[Raw transfer]




NAD_B_5(3PJE)
FABI_ECOLI
[Raw transfer]




NAD_A_4(4JX8)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1LXC)
FABI_ECOLI
[Raw transfer]




NAD_E_5(1I2Z)
FABI_ECOLI
[Raw transfer]




NAD_A_5(1DFG)
FABI_ECOLI
[Raw transfer]




NAI_A_2(4BKU)
?
[Raw transfer]




NAD_A_3(4JQC)
FABI_ECOLI
[Raw transfer]




NAD_A_2(4ZJU)
?
[Raw transfer]




NAD_A_5(1DFI)
FABI_ECOLI
[Raw transfer]




NAD_B_6(1DFI)
FABI_ECOLI
[Raw transfer]




654_G_7(1I2Z)
FABI_ECOLI
[Raw transfer]




DCN_A_9(2PD4)
FABI_HELPY
[Raw transfer]




DCN_B_10(2PD4)
FABI_HELPY
[Raw transfer]




654_K_11(1I2Z)
FABI_ECOLI
[Raw transfer]




1JN_B_7(4J1N)
?
[Raw transfer]




J47_B_6(4D46)
?
[Raw transfer]




J47_A_4(4D46)
?
[Raw transfer]




826_K_11(1I30)
FABI_ECOLI
[Raw transfer]




826_I_9(1I30)
FABI_ECOLI
[Raw transfer]




21 PsiBlast_CBE 98.38100%-120 - C1 -4NR0 10.6 FABI_PSEAE
22 PsiBlast_CBE 97.58100%-118 - C1 -4NR0 11.0 FABI_PSEAE
2 PsiBlast_PDB 97.12100%-120 - C1 -4NR0 10.6 FABI_PSEAE
23 PsiBlast_CBE 96.26100%-119 - C1 -4NR0 10.5 FABI_PSEAE
1 PsiBlast_PDB 94.47100%-119 - C1 -4NQZ - FABI_PSEAE -
3 PsiBlast_PDB 86.6170%-115 - C1 -4ZJU 10.4 ?
35 PsiBlast_CBE 86.2469%-118 - C1 -1QSG - FABI_ECOLI -
28 PsiBlast_CBE 86.1169%-116 - C1 -1I2Z 10.6 FABI_ECOLI
12 PsiBlast_PDB 85.7769%-119 - C1 -4JQC 8.5 FABI_ECOLI
4 PsiBlast_PDB 85.6769%-115 - C1 -1C14 10.2 FABI_ECOLI
37 PsiBlast_CBE 85.4469%-116 - C1 -1QG6 9.9 FABI_ECOLI
30 PsiBlast_CBE 85.3169%-119 - C1 -1QSG - FABI_ECOLI -
38 PsiBlast_CBE 85.2869%-116 - C1 -1QG6 9.9 FABI_ECOLI
36 PsiBlast_CBE 85.2869%-118 - C1 -1QSG - FABI_ECOLI -
11 PsiBlast_PDB 85.2869%-117 - C1 -1QSG - FABI_ECOLI -
98 PsiBlast_CBE 85.1762%-117 - C1 -4M87 10.1 ?
39 PsiBlast_CBE 85.0969%-116 - C1 -1QG6 9.9 FABI_ECOLI
13 PsiBlast_PDB 84.8269%-115 - C1 -4JX8 8.3 FABI_ECOLI
32 PsiBlast_CBE 84.8069%-117 - C1 -1QSG - FABI_ECOLI -
29 PsiBlast_CBE 84.7069%-114 - C1 -1C14 10.4 FABI_ECOLI
9 PsiBlast_PDB 84.6469%-116 - C1 -1MFP 10.3 FABI_ECOLI
17 PsiBlast_PDB 84.6069%-116 - C1 -1QG6 9.9 FABI_ECOLI
50 PsiBlast_CBE 84.5869%-116 - C1 -3PJD 10.4 FABI_ECOLI
95 PsiBlast_CBE 84.3762%-115 - C1 -4M89 10.3 ?
25 PsiBlast_CBE 84.2569%-117 - C1 -1LXC 10.0 FABI_ECOLI
45 PsiBlast_CBE 84.0069%-116 - C1 -1D8A 8.6 FABI_ECOLI
15 PsiBlast_PDB 83.9069%-112 - C1 -1DFH 9.0 FABI_ECOLI
24 PsiBlast_CBE 83.8869%-116 - C1 -1MFP 9.9 FABI_ECOLI
52 PsiBlast_CBE 83.8169%-116 - C1 -3PJE 10.1 FABI_ECOLI
43 PsiBlast_CBE 83.7269%-112 - C1 -1DFH 9.2 FABI_ECOLI
46 PsiBlast_CBE 83.7069%-116 - C1 -4D46 10.2 ?
56 PsiBlast_CBE 83.4665%-115 - C1 -4BKU 9.0 ?
96 PsiBlast_CBE 83.2962%-116 * C1 *4M89 10.6 ?
5 PsiBlast_PDB 83.0269%-117 - C1 -1I2Z 10.1 FABI_ECOLI
20 PsiBlast_PDB 82.7869%-118 - C1 -4CV3 10.0 ?
53 PsiBlast_CBE 82.7469%-114 - C1 -3PJE 10.1 FABI_ECOLI
49 PsiBlast_CBE 82.7069%-119 - C1 -4CV2 9.3 ?
41 PsiBlast_CBE 82.6969%-117 - C1 -1DFI 7.6 FABI_ECOLI
44 PsiBlast_CBE 82.5269%-113 - C1 -1DFG 9.0 FABI_ECOLI
54 PsiBlast_CBE 82.4869%-116 - C1 -3PJF 9.8 FABI_ECOLI
47 PsiBlast_CBE 82.4369%-121 - C1 -4D46 9.5 ?
97 PsiBlast_CBE 82.3362%-118 - C1 -4M87 8.7 ?
51 PsiBlast_CBE 82.1869%-116 - C1 -3PJD 9.8 FABI_ECOLI
48 PsiBlast_CBE 82.0469%-119 - C1 -4CV3 10.0 ?
7 PsiBlast_PDB 82.0469%-119 - C1 -1LX6 9.0 FABI_ECOLI
26 PsiBlast_CBE 81.9569%-118 - C1 -1LX6 9.3 FABI_ECOLI
42 PsiBlast_CBE 81.9069%-118 - C1 -1DFI 6.9 FABI_ECOLI
106 PsiBlast_CBE 81.7648%-117 - C1 -2PD3 10.5 FABI_HELPY
16 PsiBlast_PDB 81.7069%-117 - C1 -1DFI 7.0 FABI_ECOLI
14 PsiBlast_PDB 81.6869%-114 - C1 -1DFG 9.0 FABI_ECOLI
105 PsiBlast_CBE 81.6648%-118 - C1 -2PD4 10.0 FABI_HELPY
110 PsiBlast_CBE 81.6046%-119 - C1 -3OJF 10.2 FABI_BACCR
8 PsiBlast_PDB 81.3569%-117 - C1 -1LXC 9.6 FABI_ECOLI
104 PsiBlast_CBE 81.3448%-118 - C1 -2PD4 10.7 FABI_HELPY
6 PsiBlast_PDB 81.2669%-116 - C1 -1I30 10.1 FABI_ECOLI
27 PsiBlast_CBE 81.1969%-116 - C1 -1I30 9.4 FABI_ECOLI
102 PsiBlast_CBE 81.0548%-118 - C1 -2PD4 10.6 FABI_HELPY
103 PsiBlast_CBE 81.0148%-119 - C1 -2PD4 11.1 FABI_HELPY
18 PsiBlast_PDB 81.0169%-115 - C1 -1D8A 9.1 FABI_ECOLI
19 PsiBlast_PDB 80.7669%-119 - C1 -4CV2 9.4 ?
40 PsiBlast_CBE 80.6769%-114 - C1 -1DFI 7.7 FABI_ECOLI
93 PsiBlast_CBE 80.5260%-114 - C1 -3NRC 10.1 ?
109 PsiBlast_CBE 80.4848%-119 - C1 -2PD3 9.9 FABI_HELPY
107 PsiBlast_CBE 80.4448%-116 - C1 -2PD3 9.9 FABI_HELPY
108 PsiBlast_CBE 80.4048%-116 - C1 -2PD3 9.4 FABI_HELPY
99 PsiBlast_CBE 80.2449%-117 - C1 -3OIG 9.0 FABI_BACSU
100 PsiBlast_CBE 79.9849%-115 - C1 -3OIF 7.0 FABI_BACSU
75 PsiBlast_CBE 79.9460%-117 - C1 -4J1N 10.0 ?
55 PsiBlast_CBE 79.8669%-115 - C1 -3PJF 9.5 FABI_ECOLI
76 PsiBlast_CBE 79.7060%-116 - C1 -4J1N 10.1 ?
94 PsiBlast_CBE 78.5560%-113 - C1 -3NRC 10.0 ?
101 PsiBlast_CBE 78.0649%-115 - C1 -3OIF 7.2 FABI_BACSU
58 PsiBlast_CBE 77.3360%-120 - C1 -2JJY 8.0 ?
111 PsiBlast_CBE 76.5346%-116 - C1 -3OJF 6.8 FABI_BACCR
112 Fugue 70.5865%-123 - C1 -1DFI 6.5 FABI_ECOLI