@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1871: (2016-02-02 )
MQHKRSRAMASPRSPFLFVLLALAVGGTANAHDDGLPAFRYSAELLGQLQLPSVALPLNDDLFLYGRDAEAFDLEAYLALNAPALRDKSEYLEHWSGYYSINPKVLLTLMVMQSGPLGAPDERALAAPLGRLSAKRGFDAQVRDVLQQLSRRYYGFEEYQLRQAAARKAVGEDGLNAASAALLGLLREGAKVSAVQGGNPLGAYAQTFQRLFGTPAAELLQPSNRVARQLQAKAALAPPSNLMQLPWRQGYSWQPNGAHSNTGSGYPYSSFDASYDWPRWGSATYSVVAAHAGTVRVLSRCQVRVTHPSGWATNYYHMDQIQVSNGQQVSADTKLGVYAGNINTALCEGGSSTGPHLHFSLLYNGAFVSLQGASFGPYRINVGTSNYDNDCRRYYFYNQSAGTTHCAFRPLYNPGLAL

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

TLA_B_8(3IT7)

[Raw transfer]




TLA_A_4(3IT7)
LASA_PSEAE
[Raw transfer]




11 PsiBlast_CBE 98.52100% -99 - C3 -3IT7 4.8
37 Fugue 97.21100% -99 - C3 -3IT5 - LASA_PSEAE -
14 PsiBlast_CBE 97.17100%-102 - C3 -3IT5 - LASA_PSEAE -
1 PsiBlast_PDB 96.72100% -99 - C3 -3IT5 - LASA_PSEAE -
12 PsiBlast_CBE 96.67100% -95 - C3 -3IT5 - -
13 PsiBlast_CBE 96.53100% -99 - C3 -3IT5 - LASA_PSEAE -
2 PsiBlast_PDB 96.23100%-101 - C3 -3IT7 2.9 LASA_PSEAE
15 HHSearch 90.9593% -89 - C3 -3IT5 - LASA_PSEAE -
4 PsiBlast_PDB 62.4027% -67 - C3 -2HSI - ? -
43 Fugue 60.5817% -49 - C1 -4Q6O - ? -
42 Fugue 57.3014% -41 - C3 -3SLU - ? -
40 Fugue 56.8415% -66 - C3 -2GU1 - ? -
18 HHSearch 55.8230% -97 - C3 -2GU1 - ? -
20 HHSearch 55.0325% -86 - C3 -3NYY - ? -
39 Fugue 54.5815% -18 - C3 -2HSI - ? -
19 HHSearch 52.2324% -82 - C3 -1QWY - LYTM_STAA8 -
38 Fugue 52.1613% -37 - C3 -3NYY - ? -
17 HHSearch 51.6024% -85 - C3 -3TUF - SP2Q_BACSU -
3 PsiBlast_PDB 50.8530% -64 - C3 -2GU1 - ? -
21 HHSearch 48.8624% -78 - C3 -3SLU - ? -