@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA1962: (2016-02-02 )
MKLLHIDSSILGDASASRQLSAELVQAWRQNEDGLDVTYRDLAADAVAHFSALTLAAGSTPAELRDAALKHEVAVGEEVLEEFLAADVVVIGAPMYNFTISSQLKAWIDRIAVAGKTFRYTENGPVGLAGDKKVVIVSTAGGVHAGQPTGAAHEGYLRTVLGFFGITDIEVVRAEGLAYGEEPRTQAIAAARRQIAGQFAAA

Atome Classification :

(22 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_B_4(2Z9D)
AZOR_ECOLI
[Raw transfer]




FMN_C_3(1T5B)
AZOR_SALTY
[Raw transfer]




FMN_D_4(1T5B)
AZOR_SALTY
[Raw transfer]




FMN_C_3(1T5B)
AZOR_SALTY
[Raw transfer]




FMN_A_2(2D5I)
AZOR_ECOLI
[Raw transfer]




FMN_A_3(2Z9D)
AZOR_ECOLI
[Raw transfer]




FMN_A_2(4C0X)
AZOR1_PSEPK
[Raw transfer]




FMN_A_2(2Z9C)
AZOR_ECOLI
[Raw transfer]




FMN_A_2(2Z98)
AZOR_ECOLI
[Raw transfer]




FMN_A_2(1V4B)
AZOR_ECOLI
[Raw transfer]




AQN_A_3(4C0X)
AZOR1_PSEPK
[Raw transfer]




FMN_A_3(4ESE)
AZOR_YERPE
[Raw transfer]




DTC_A_3(2Z9C)
AZOR_ECOLI
[Raw transfer]




RE8_A_7(3W7A)
?
[Raw transfer]




RE8_A_6(3W7A)
?
[Raw transfer]




1 PsiBlast_PDB 90.7170%-110 - C1 -4C0X 9.3 AZOR1_PSEPK
8 PsiBlast_PDB 82.4643%-115 - C1 -4ESE 6.9 AZOR_YERPE
101 Fugue 80.7040%-103 - C1 -1TIK - AZOR_ECOLI -
112 HHSearch 79.7441%-106 - C1 -1T5B 7.6 AZOR_SALTY
22 PsiBlast_CBE 79.3944%-117 - C1 -1T5B 7.9 AZOR_SALTY
21 PsiBlast_CBE 79.3643%-113 - C1 -2Z9D 8.8 AZOR_ECOLI
6 PsiBlast_PDB 79.2943%-115 - C1 -2Z9D 8.7 AZOR_ECOLI
5 PsiBlast_PDB 78.1743%-115 - C1 -2Z9C 7.8 AZOR_ECOLI
2 PsiBlast_PDB 78.0443%-113 * C1 *1V4B 8.4 AZOR_ECOLI
4 PsiBlast_PDB 77.9943%-115 - C1 -2Z98 8.5 AZOR_ECOLI
7 PsiBlast_PDB 77.8043%-110 - C1 -1TIK - AZOR_ECOLI -
3 PsiBlast_PDB 77.4343%-114 - C1 -2D5I 8.2 AZOR_ECOLI
9 PsiBlast_PDB 77.2144%-116 - C1 -1T5B 8.0 AZOR_SALTY
113 HHSearch 70.4630% -98 - C1 -3W7A - ? -
35 PsiBlast_CBE 66.4331%-104 - C1 -4N9Q - AZOR1_PSEAE -
38 PsiBlast_CBE 65.9531%-103 - C1 -3LT5 - AZOR1_PSEAE -
37 PsiBlast_CBE 65.6731%-101 - C1 -3R6W - AZOR1_PSEAE -
18 PsiBlast_PDB 65.0331%-104 - C1 -3R6W - AZOR1_PSEAE -
36 PsiBlast_CBE 64.9931%-101 - C1 -4N65 - AZOR1_PSEAE -
34 PsiBlast_CBE 64.3831%-103 - C1 -2V9C - AZOR1_PSEAE -
26 PsiBlast_CBE 60.0241%-121 - C1 -3W7A 2.6 ?
13 PsiBlast_PDB 59.6841%-128 - C1 -3W7A 2.3 ?