@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA2025: (2016-02-03 )
MSFDFDLFVIGAGSGGVRAARFAAGFGARVAVAESRYLGGTCVNVGCVPKKLLVYGAHFSEDFEQARAYGWSAGEAQFDWATLIGNKNREIQRLNGIYRNLLVNSGVTLLEGHARLLDAHSVEVDGQRFSAKHILVATGGWPQVPDIPGKEHAITSNEAFFLERLPRRVLVVGGGYIAVEFASIFNGLGAETTLLYRRDLFLRGFDRSVREHLRDELGKKGLDLQFNSDIARIDKQADGSLAATLKDGRVLEADCVFYATGRRPMLDDLGLENTAVKLTDKGFIAVDEHYQTSEPSILALGDVIGRVQLTPVALAEGMAVARRLFKPEEYRPVDYKLIPTAVFSLPNIGTVGLTEEEALSAGHKVKIFESRFRPMKLTLTDDQEKTLMKLVVDAHDDRVLGCHMVGAEAGEILQGIAVAMKAGATKQAFDETIGIHPTAAEEFVTLRTPTR

Atome Classification :

(75 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FAD_E_5(1GRF)
GSHR_HUMAN
[Raw transfer]




FAD_B_8(3SQP)
GSHR_HUMAN
[Raw transfer]




FAD_E_5(1GRB)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(2W0H)
?
[Raw transfer]




FAD_X_2(3DJG)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(3DK4)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(3SQP)
GSHR_HUMAN
[Raw transfer]




FAD_A_4(3DK8)
GSHR_HUMAN
[Raw transfer]




FAD_A_5(3DK9)
GSHR_HUMAN
[Raw transfer]




FAD_B_7(2W0H)
?
[Raw transfer]




FAD_A_3(3LAD)
DLDH_AZOVI
[Raw transfer]




FAD_A_9(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_A_5(3DK9)
GSHR_HUMAN
[Raw transfer]




FAD_A_11(3DJJ)
GSHR_HUMAN
[Raw transfer]




FAD_E_5(1GRE)
GSHR_HUMAN
[Raw transfer]




FAD_B_10(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_A_3(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_C_3(1ONF)
GSHR_PLAFK
[Raw transfer]




FAD_E_5(4GR1)
GSHR_HUMAN
[Raw transfer]




FAD_A_8(2AAQ)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_C_3(1BZL)
TYTR_TRYCR
[Raw transfer]




FAD_A_3(4ADW)
?
[Raw transfer]




FAD_A_3(4APN)
?
[Raw transfer]




FAD_C_3(1GRA)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(2X50)
?
[Raw transfer]




FAD_A_3(1TYP)
TYTR_CRIFA
[Raw transfer]




FAD_E_5(3GRS)
GSHR_HUMAN
[Raw transfer]




FAD_C_3(1GRT)
GSHR_HUMAN
[Raw transfer]




FAD_B_8(2X50)
?
[Raw transfer]




FAD_D_4(1BZL)
TYTR_TRYCR
[Raw transfer]




FAD_A_3(2R9Z)
GASHR_MARGR
[Raw transfer]




FAD_C_3(1XAN)
GSHR_HUMAN
[Raw transfer]




FAD_B_9(2YAU)
?
[Raw transfer]




FAD_A_3(4DNA)
?
[Raw transfer]




FAD_B_7(1GXF)
TYTR_TRYCR
[Raw transfer]




FAD_A_3(2JK6)
?
[Raw transfer]




FAD_B_7(2JK6)
?
[Raw transfer]




FAD_A_3(2WBA)
TYTR_TRYBB
[Raw transfer]




FAD_C_3(3GRT)
GSHR_HUMAN
[Raw transfer]




FAD_B_6(4ADW)
?
[Raw transfer]




FAD_A_2(4NEW)
?
[Raw transfer]




FAD_C_3(4GRT)
GSHR_HUMAN
[Raw transfer]




FAD_B_10(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_B_11(2WBA)
TYTR_TRYBB
[Raw transfer]




FAD_A_2(3H4K)
?
[Raw transfer]




FAD_A_3(1GXF)
TYTR_TRYCR
[Raw transfer]




FAD_A_3(1FEC)
TYTR_CRIFA
[Raw transfer]




FAD_A_3(4NEV)
?
[Raw transfer]




FAD_A_3(1TYT)
TYTR_CRIFA
[Raw transfer]




FAD_A_3(1FEC)
TYTR_CRIFA
[Raw transfer]




FAD_B_4(1FEC)
TYTR_CRIFA
[Raw transfer]




FAD_B_8(4NEV)
?
[Raw transfer]




FAD_B_4(1TYT)
TYTR_CRIFA
[Raw transfer]




FAD_A_5(3O0H)
?
[Raw transfer]




FAD_A_3(1BWC)
GSHR_HUMAN
[Raw transfer]




FAD_B_6(1AOG)
TYTR_TRYCR
[Raw transfer]




FAD_A_3(1AOG)
TYTR_TRYCR
[Raw transfer]




FAD_B_7(1TYP)
TYTR_CRIFA
[Raw transfer]




FAD_C_3(2GRT)
GSHR_HUMAN
[Raw transfer]




FAD_B_5(4APN)
?
[Raw transfer]




ELI_A_7(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_A_5(3O0H)
?
[Raw transfer]




FAD_B_5(1GEU)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(1GET)
GSHR_ECOLI
[Raw transfer]




FAD_B_5(1GET)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(2YAU)
?
[Raw transfer]




ELI_B_8(2GH5)
GSHR_HUMAN
[Raw transfer]




FAD_A_3(1GER)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(1GEU)
GSHR_ECOLI
[Raw transfer]




FAD_B_4(1GES)
GSHR_ECOLI
[Raw transfer]




FAD_B_4(1GER)
GSHR_ECOLI
[Raw transfer]




FAD_A_3(1GES)
GSHR_ECOLI
[Raw transfer]




ACM_G_7(1GRF)
GSHR_HUMAN
[Raw transfer]




AJ3_A_4(1BWC)
GSHR_HUMAN
[Raw transfer]




TS4_E_5(5GRT)
GSHR_HUMAN
[Raw transfer]




1 PsiBlast_PDB 97.0046%-109 - C1 -3O0H 12.9 ?
112 HHSearch 96.9647%-108 - C1 -3O0H 12.9 ?
126 HHSearch 90.8545%-104 - C1 -3DK9 13.8 GSHR_HUMAN
83 PsiBlast_CBE 90.7641%-103 - C1 -2X50 12.7 ?
69 PsiBlast_CBE 90.3643%-107 - C1 -1GRA 13.6 GSHR_HUMAN
111 HHSearch 90.3344%-104 - C1 -1GES 13.5 GSHR_ECOLI
72 PsiBlast_CBE 90.1441% -99 - C1 -4APN 12.3 ?
70 PsiBlast_CBE 90.0343%-106 - C1 -1BWC 12.9 GSHR_HUMAN
79 PsiBlast_CBE 89.7341%-102 - C1 -2W0H 12.4 ?
71 PsiBlast_CBE 89.6643%-104 - C1 -1XAN 14.0 GSHR_HUMAN
61 PsiBlast_CBE 89.5643%-106 - C1 -3DK4 14.0 GSHR_HUMAN
41 PsiBlast_CBE 89.5442%-106 - C1 -2WOW - ? -
59 PsiBlast_CBE 89.4343%-104 - C1 -3DK9 13.8 GSHR_HUMAN
67 PsiBlast_CBE 89.4143%-104 - C1 -1GRE 13.4 GSHR_HUMAN
8 PsiBlast_PDB 89.2142%-106 - C1 -2WOW - ? -
66 PsiBlast_CBE 89.1743%-105 - C1 -1GRF 13.7 GSHR_HUMAN
57 PsiBlast_CBE 89.1543%-102 - C1 -3SQP 13.5 GSHR_HUMAN
56 PsiBlast_CBE 89.1043%-102 - C1 -3SQP 13.3 GSHR_HUMAN
2 PsiBlast_PDB 89.0747%-105 - C1 -4DNA 11.7 ?
26 PsiBlast_CBE 88.9842%-105 - C1 -2WPF - ? -
62 PsiBlast_CBE 88.9443%-103 - C1 -3DJJ 13.6 GSHR_HUMAN
78 PsiBlast_CBE 88.9341%-102 - C1 -2W0H 12.3 ?
73 PsiBlast_CBE 88.9041%-101 - C1 -4APN 12.3 ?
63 PsiBlast_CBE 88.5843%-103 - C1 -3DJG 13.6 GSHR_HUMAN
82 PsiBlast_CBE 88.4741%-102 - C1 -2X50 12.5 ?
60 PsiBlast_CBE 88.4143%-104 - C1 -3DK8 14.0 GSHR_HUMAN
68 PsiBlast_CBE 88.3643%-103 - C1 -1GRB 13.2 GSHR_HUMAN
55 PsiBlast_CBE 88.1343%-102 - C1 -4GR1 13.6 GSHR_HUMAN
65 PsiBlast_CBE 87.9843%-104 - C1 -2GH5 13.8 GSHR_HUMAN
80 PsiBlast_CBE 87.9241% -99 - C1 -2JK6 13.2 ?
81 PsiBlast_CBE 87.7541%-100 - C1 -2JK6 13.0 ?
89 PsiBlast_CBE 87.7240%-103 - C1 -1AOG 10.8 TYTR_TRYCR
86 PsiBlast_CBE 87.6340%-103 - C1 -1GXF 11.4 TYTR_TRYCR
64 PsiBlast_CBE 87.5143%-103 - C1 -2GH5 13.8 GSHR_HUMAN
21 PsiBlast_CBE 87.5043%-100 - C1 -2R9Z 13.1 GASHR_MARGR
85 PsiBlast_CBE 87.3340%-105 - C1 -1BZL 12.6 TYTR_TRYCR
16 PsiBlast_PDB 87.3043%-103 - C1 -2GRT 11.8 GSHR_HUMAN
77 PsiBlast_CBE 87.0941%-101 - C1 -2YAU 12.1 ?
76 PsiBlast_CBE 86.7841%-103 - C1 -2YAU 12.1 ?
90 PsiBlast_CBE 86.7340%-105 - C1 -1AOG 13.1 TYTR_TRYCR
87 PsiBlast_CBE 86.7240%-103 - C1 -1GXF 11.6 TYTR_TRYCR
24 PsiBlast_CBE 86.7242%-105 - C1 -4NEV 12.6 ?
58 PsiBlast_CBE 86.6943%-102 - C1 -3GRS 13.6 GSHR_HUMAN
54 PsiBlast_CBE 86.4643%-102 - C1 -2AAQ 12.8 GSHR_HUMAN
84 PsiBlast_CBE 86.2840%-100 - C1 -1BZL 11.7 TYTR_TRYCR
19 PsiBlast_PDB 86.1043%-103 - C1 -5GRT 1.6 GSHR_HUMAN
125 HHSearch 85.8343%-102 - C1 -2R9Z 13.6 GASHR_MARGR
14 PsiBlast_PDB 85.8342%-104 - C1 -4NEV 13.2 ?
75 PsiBlast_CBE 85.7041%-101 - C1 -4ADW 11.6 ?
49 PsiBlast_CBE 85.5442%-105 - C1 -2WBA 12.9 TYTR_TRYBB
99 PsiBlast_CBE 85.3339%-103 - C1 -1FEC 13.4 TYTR_CRIFA
96 PsiBlast_CBE 85.3039%-103 - C1 -1TYP 13.0 TYTR_CRIFA
74 PsiBlast_CBE 85.2441%-104 - C1 -4ADW 11.6 ?
3 PsiBlast_PDB 85.2443% -99 - C1 -2R9Z 13.6 GASHR_MARGR
88 PsiBlast_CBE 85.2140%-103 - C1 -4NEW 11.2 ?
118 HHSearch 85.1541%-102 * C1 *1FEC 13.0 TYTR_CRIFA
114 HHSearch 84.9043%-104 - C1 -1ONF 9.9 GSHR_PLAFK
17 PsiBlast_PDB 84.9043%-102 - C1 -3GRT 13.0 GSHR_HUMAN
20 PsiBlast_PDB 84.7743%-102 - C1 -1GRT 13.1 GSHR_HUMAN
100 PsiBlast_CBE 84.6839%-104 - C1 -1FEC 12.8 TYTR_CRIFA
95 PsiBlast_CBE 84.1439%-101 - C1 -1TYP 12.6 TYTR_CRIFA
15 PsiBlast_PDB 84.0642%-103 - C1 -2WBA 12.5 TYTR_TRYBB
98 PsiBlast_CBE 84.0139%-102 - C1 -1TYT 13.1 TYTR_CRIFA
101 Fugue 83.8738%-104 - C1 -3H4K 12.2 ?
18 PsiBlast_PDB 83.6543%-105 - C1 -4GRT 11.0 GSHR_HUMAN
97 PsiBlast_CBE 81.8539% -99 - C1 -1TYT 13.2 TYTR_CRIFA
4 PsiBlast_PDB 79.8045%-101 - C1 -1GER 12.2 GSHR_ECOLI
53 PsiBlast_CBE 79.2244%-100 - C1 -1GES 12.0 GSHR_ECOLI
52 PsiBlast_CBE 78.5944%-100 - C1 -1GES 12.5 GSHR_ECOLI
23 PsiBlast_CBE 78.5845% -99 - C1 -1GER 12.3 GSHR_ECOLI
22 PsiBlast_CBE 77.8545% -98 - C1 -1GET 11.8 GSHR_ECOLI
5 PsiBlast_PDB 77.6045%-100 - C1 -1GET 11.1 GSHR_ECOLI
51 PsiBlast_CBE 77.4644% -98 - C1 -1GEU 11.2 GSHR_ECOLI
50 PsiBlast_CBE 76.7344% -99 - C1 -1GEU 12.0 GSHR_ECOLI
123 HHSearch 75.2231%-102 - C1 -3LAD 12.2 DLDH_AZOVI