@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA2142: (2016-02-04 )
MSEQRQTLPAQHQDQRPGHESQMQPKPEFVSADYRPAAKLEGKVALVTGGDSGIGRAVAVAFAREKADVVLVYLDENEDAAKTREIIESLGRQCLAFAGDVADAGFCRQVVDTLRQKWGRLDVLVNNAGEQHPQARLEDISEEQWEKTFRTNIFGMFQLTKAALPLMGKGGAIINTTSITAYKGNPQLIDYSSTKGAITSFTRSLSMNLVNRGIRVNAVAPGPIWTPLIPSTFSAEKVAHFGADTPMGRPGQPEELAASYVYLACNDSSYVSGQVLHVNGGTVVNG

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_B_8(3R3S)
?
[Raw transfer]




NAD_C_12(3R3S)
?
[Raw transfer]




NAD_A_5(3R3S)
?
[Raw transfer]




NAD_D_15(3R3S)
?
[Raw transfer]




FMT_D_16(3R3S)
?
[Raw transfer]




FMT_C_13(3R3S)
?
[Raw transfer]




25 PsiBlast_CBE 93.0456% -74 - C1 -3I3O - ? -
1 PsiBlast_PDB 92.5056% -74 - C1 -3I3O - ? -
121 HHSearch 92.4857% -74 - C1 -3IJR - ? -
27 PsiBlast_CBE 92.3856% -75 - C1 -3I3O - ? -
2 PsiBlast_PDB 92.2856% -75 - C1 -3IJR - ? -
26 PsiBlast_CBE 91.7156% -75 - C1 -3I3O - ? -
24 PsiBlast_CBE 90.6256% -71 - C1 -3I3O - ? -
23 PsiBlast_CBE 89.5256% -75 - C1 -3I3O - ? -
21 PsiBlast_CBE 87.7256% -75 - C1 -3I3O - ? -
29 PsiBlast_CBE 83.1646% -67 - C1 -3R3S 12.1 ?
30 PsiBlast_CBE 82.5946% -68 - C1 -3R3S 12.0 ?
28 PsiBlast_CBE 82.3846% -66 - C1 -3R3S 11.6 ?
3 PsiBlast_PDB 82.3546% -67 - C1 -3R3S 11.9 ?
5 PsiBlast_PDB 75.8740% -85 - C1 -4I5G - ? -
48 PsiBlast_CBE 74.5039% -80 - C1 -4BMN - ? -
40 PsiBlast_CBE 74.3640% -77 - C1 -4I5D - ? -
45 PsiBlast_CBE 74.2640% -80 - C1 -4I5D - ? -
39 PsiBlast_CBE 74.1940% -77 - C1 -4I5D - ? -
9 PsiBlast_PDB 74.1739% -80 - C1 -4BMN - ? -
31 PsiBlast_CBE 73.8940% -82 - C1 -4MOW - ? -