@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA2482: (2016-02-08 )
MPVAHRLLFSLTALLAATAQAAVDGQKLYTQGGANPAAAACVTCHGADGMGLAAAGFPRLAGLPAAYLSKQLHDLKQGGSREHPVMKGIADALGDDEIQALANTLAAMPAPKPVELSRVATPRSPGETLAVRGAWERNIPECVTCHGPAGSGVGEAFPPLQGQGEMYLSNQLRAWQLGTRRNDPNDLMGHIAKSLSEEEIRSVSQFFATLGQAGGQP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

HEC_D_11(1M70)
CYC4_PSEST
[Raw transfer]




HEC_D_11(1M6Z)
CYC4_PSEST
[Raw transfer]




HEM_B_5(1ETP)
CYC4_PSEST
[Raw transfer]




HEC_C_10(1M6Z)
CYC4_PSEST
[Raw transfer]




HEM_A_4(1ETP)
CYC4_PSEST
[Raw transfer]




HEC_A_6(1M70)
CYC4_PSEST
[Raw transfer]




HEC_A_6(1M6Z)
CYC4_PSEST
[Raw transfer]




HEM_B_6(1ETP)
CYC4_PSEST
[Raw transfer]




HEC_C_10(1M70)
CYC4_PSEST
[Raw transfer]




HEM_A_3(1H1O)
CY552_ACIFR
[Raw transfer]




GOL_B_9(1H1O)
CY552_ACIFR
[Raw transfer]




GOL_B_9(1H1O)
CY552_ACIFR
[Raw transfer]




GOL_B_9(1H1O)
CY552_ACIFR
[Raw transfer]




HEC_C_10(1M70)
CYC4_PSEST
[Raw transfer]




HEC_B_8(1M6Z)
CYC4_PSEST
[Raw transfer]




HEC_B_8(1M70)
CYC4_PSEST
[Raw transfer]




24 PsiBlast_CBE 87.9833% -55 - C4 -1M6Z 2.8 CYC4_PSEST
21 PsiBlast_CBE 87.8933% -58 - C4 -1M70 3.0 CYC4_PSEST
26 PsiBlast_CBE 87.6733% -55 - C4 -1M6Z Error CYC4_PSEST
25 PsiBlast_CBE 87.3733% -54 - C4 -1M6Z 9.8 CYC4_PSEST
22 PsiBlast_CBE 87.2833% -54 - C4 -1M70 10.1 CYC4_PSEST
1 PsiBlast_PDB 87.1533% -56 - C4 -1ETP 8.3 CYC4_PSEST
23 PsiBlast_CBE 86.9333% -55 - C4 -1M70 3.0 CYC4_PSEST
3 PsiBlast_PDB 86.4033% -53 - C4 -1M70 9.6 CYC4_PSEST
27 PsiBlast_CBE 86.3633% -53 - C4 -1ETP 10.1 CYC4_PSEST
28 PsiBlast_CBE 86.3431% -62 - C4 -1H1O 3.2 CY552_ACIFR
2 PsiBlast_PDB 84.8833% -56 - C4 -1M6Z 9.8 CYC4_PSEST
66 HHSearch 82.8433% -47 - C4 -1M70 - CYC4_PSEST -
4 PsiBlast_PDB 81.1831% -60 - C4 -1H1O 2.8 CY552_ACIFR
65 HHSearch 81.0031% -56 - C4 -1H1O 2.8 CY552_ACIFR
88 Fugue 79.4031% -45 - C4 -1ETP - CYC4_PSEST -
95 Fugue 68.6222% -44 - C3 -3MK7 - CCOP1_PSEST -
33 PsiBlast_CBE 63.3845% -93 - C4 -4O1W - ? -
29 PsiBlast_CBE 62.3145% -91 - C4 -4O1W - ? -
64 HHSearch 62.0020% -47 - C4 -3VRD - ? -
30 PsiBlast_CBE 61.6745% -94 - C4 -4O1W - ? -