@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA2709: (2016-02-10 )
MSRIFADNAQSIGNTPLVQINRIAPRGVTILAKIEGRNPGYSVKCRIGANMIWDAEASGRLKSGMTLVEPTSGNTGIGLAFVAAARGYKLILTMPASMSLERRKVLKALGAELVLTEPAKGMKGAIQKAEELVAGDPGKYFMPQQFDNPANPAIHEKTTGPEIWNDTEGAVDVLVSGVGTGGTLTGVSRYIKNTRGKPILAVAVEPVTSPVISQTLAGEEVKPAPHKIQGIGAGFVPKNLDLSLVDRVEKIGDDEAKNMALRLMQEEGILCGISSGAAMAAAVRLAEEPNMQGKTIVVILPDSGERYLSSMLFDGLFSEQELTQ

Atome Classification :

(65 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PUS_A_3(3X44)
?
[Raw transfer]




KOU_A_3(3PC4)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




PUS_A_3(3X44)
?
[Raw transfer]




P1T_A_3(3PC3)
?
[Raw transfer]




PUS_B_4(3X44)
?
[Raw transfer]




PDA_A_2(2Q3D)
CYSK_MYCTU
[Raw transfer]




AA5_A_2(1Z7Y)
CYSK1_ARATH
[Raw transfer]




CYS_A_2(4LMB)
?
[Raw transfer]




AWH_A_3(3ZEI)
CYSK_MYCTU
[Raw transfer]




OAS_X_3(4ZU6)
CYSK_HAEIN
[Raw transfer]




PLP_D_4(1D6S)
CYSK_SALTY
[Raw transfer]




FGA_B_11(4AIR)
?
[Raw transfer]




4AT_A_4(2EFY)
?
[Raw transfer]




PLP_E_5(1D6S)
CYSK_SALTY
[Raw transfer]




4AT_B_6(2EFY)
?
[Raw transfer]




PLP_B_10(3BM5)
?
[Raw transfer]




4MV_A_3(2ECO)
?
[Raw transfer]




P1T_X_3(5DBH)
?
[Raw transfer]




PLP_B_6(3VBE)
?
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_A_4(4LMB)
?
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_A_5(4LMA)
?
[Raw transfer]




PLP_D_16(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_3(1Z7W)
CYSK1_ARATH
[Raw transfer]




PLP_A_3(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_A_9(3BM5)
?
[Raw transfer]




PLP_C_7(3VBE)
?
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_B_7(4LMA)
?
[Raw transfer]




PLP_B_5(4AEC)
CYSKM_ARATH
[Raw transfer]




PLP_B_15(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_A_13(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_C_9(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_4(3DWG)
CYSM_MYCTU
[Raw transfer]




PLP_A_3(3PC2)
?
[Raw transfer]




PLP_C_14(1FCJ)
CYSK_SALTY
[Raw transfer]




PLP_B_5(4L0D)
CBS_HUMAN
[Raw transfer]




PLP_A_5(3VBE)
?
[Raw transfer]




PLP_A_5(2PQM)
?
[Raw transfer]




PLP_X_4(4ZU6)
CYSK_HAEIN
[Raw transfer]




PLP_B_4(1OAS)
CYSK_SALTY
[Raw transfer]




PLP_B_6(2PQM)
?
[Raw transfer]




PLP_A_2(2ECO)
?
[Raw transfer]




PLP_A_3(1VE1)
?
[Raw transfer]




PLP_A_2(2ECQ)
?
[Raw transfer]




PLP_A_3(2EFY)
?
[Raw transfer]




PLP_B_5(2EFY)
?
[Raw transfer]




PLP_A_7(2BHS)
CYSM_ECOLI
[Raw transfer]




FGA_B_12(4AIR)
?
[Raw transfer]




PLP_D_11(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_A_5(4COO)
CBS_HUMAN
[Raw transfer]




PLP_B_8(2BHS)
CYSM_ECOLI
[Raw transfer]




PLP_D_8(3VBE)
?
[Raw transfer]




PLP_A_3(1OAS)
CYSK_SALTY
[Raw transfer]




CYS_A_3(4LMB)
?
[Raw transfer]




3HL_A_3(2ECQ)
?
[Raw transfer]




FGA_B_9(4AIR)
?
[Raw transfer]




CHAIN_P_3(1Y7L)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_P_3(1Y7L)
CYSK_HAEIN
[Raw transfer]

-

OAS_A_4(4ZU1)
CYSK_HAEIN
[Raw transfer]




MPD_A_6(2Q3B)
CYSK_MYCTU
[Raw transfer]




MPD_A_4(2Q3B)
CYSK_MYCTU
[Raw transfer]




CHAIN_A_2(4NU8)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_B_2(3TBH)
?
[Raw transfer]

-

CHAIN_P_2(3IQI)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_A_2(4LI3)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_P_2(3IQG)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_A_2(4ORE)
CYSK_HAEIN
[Raw transfer]

-

CHAIN_B_3(2ISQ)
CYSK1_ARATH
[Raw transfer]

-

CHAIN_P_2(3IQH)
CYSK_HAEIN
[Raw transfer]

-

101 Fugue 97.1071% -88 - C3 -1OAS 3.8 CYSK_SALTY
1 PsiBlast_PDB 96.6270% -88 - C3 -1OAS 3.8 CYSK_SALTY
3 PsiBlast_PDB 96.5269% -79 - C3 -1D6S 5.1 CYSK_SALTY
25 PsiBlast_CBE 96.4369% -80 - C3 -1D6S 4.9 CYSK_SALTY
21 PsiBlast_CBE 96.3470% -88 - C3 -1OAS 4.0 CYSK_SALTY
6 PsiBlast_PDB 95.3767% -89 - C3 -1Y7L 5.8 CYSK_HAEIN
4 PsiBlast_PDB 95.1467% -79 - C3 -5DBH 7.6 ?
10 PsiBlast_PDB 94.7767% -87 - C3 -4HO1 - CYSK_HAEIN -
22 PsiBlast_CBE 93.9670% -85 - C3 -1FCJ 3.9 CYSK_SALTY
112 HHSearch 93.8267% -87 - C3 -1Y7L 5.8 CYSK_HAEIN
24 PsiBlast_CBE 93.7470% -83 - C3 -1FCJ 3.5 CYSK_SALTY
2 PsiBlast_PDB 93.5770% -83 - C3 -1FCJ 3.6 CYSK_SALTY
23 PsiBlast_CBE 93.1270% -81 - C3 -1FCJ 3.2 CYSK_SALTY
26 PsiBlast_CBE 87.1556% -78 - C3 -4AEC 4.1 CYSKM_ARATH
31 PsiBlast_CBE 86.9054% -75 - C3 -4LMA 4.1 ?
15 PsiBlast_PDB 86.5756% -77 - C3 -4AEC 3.9 CYSKM_ARATH
115 HHSearch 86.3157% -73 - C3 -1Z7W 4.6 CYSK1_ARATH
16 PsiBlast_PDB 85.4156% -72 - C3 -2ISQ 7.8 CYSK1_ARATH
119 HHSearch 84.8746% -80 - C3 -2PQM 3.8 ?
17 PsiBlast_PDB 84.7756% -70 - C3 -1Z7W 4.6 CYSK1_ARATH
20 PsiBlast_PDB 84.7556% -68 - C3 -1Z7Y 3.4 CYSK1_ARATH
43 PsiBlast_CBE 84.7147% -73 - C3 -3VBE 4.4 ?
29 PsiBlast_CBE 84.5856% -81 - C3 -3ZEI 6.1 CYSK_MYCTU
30 PsiBlast_CBE 84.5354% -77 - C3 -4LMA 4.4 ?
55 PsiBlast_CBE 84.4849% -75 - C3 -2ECO 4.1 ?
42 PsiBlast_CBE 84.4647% -74 - C3 -3VBE 3.9 ?
28 PsiBlast_CBE 84.4256% -73 - C3 -2Q3D 8.2 CYSK_MYCTU
125 HHSearch 84.3849% -70 * C3 *1VE1 4.1 ?
56 PsiBlast_CBE 84.3049% -76 - C3 -1VE1 4.1 ?
54 PsiBlast_CBE 84.2449% -75 - C3 -2ECQ 4.1 ?
52 PsiBlast_CBE 84.1149% -74 - C3 -2EFY 3.3 ?
114 HHSearch 84.1056% -79 - C3 -2Q3B 3.0 CYSK_MYCTU
44 PsiBlast_CBE 83.8747% -76 - C3 -3VBE 3.6 ?
53 PsiBlast_CBE 83.3649% -78 - C3 -2EFY 3.4 ?
34 PsiBlast_CBE 83.3646% -79 - C3 -2PQM 4.0 ?
33 PsiBlast_CBE 83.0046% -83 - C3 -2PQM 3.8 ?
32 PsiBlast_CBE 82.7453% -70 - C3 -4LMB 4.1 ?
41 PsiBlast_CBE 82.5347% -75 - C3 -3VBE 4.2 ?
103 Fugue 82.2538% -60 - C3 -3PC3 8.5 ?
36 PsiBlast_CBE 81.7646% -78 - C3 -3BM5 4.8 ?
116 HHSearch 81.6848% -68 - C3 -3TBH 4.8 ?
35 PsiBlast_CBE 81.3946% -73 - C3 -3BM5 3.2 ?
69 PsiBlast_CBE 81.2739% -63 - C3 -4COO 4.6 CBS_HUMAN
78 PsiBlast_CBE 80.6539% -65 - C3 -4L0D 3.7 CBS_HUMAN
98 PsiBlast_CBE 80.4038% -67 - C3 -3PC2 4.1 ?
96 PsiBlast_CBE 80.3238% -64 - C3 -3PC4 6.0 ?
97 PsiBlast_CBE 80.2538% -62 - C3 -3PC3 8.5 ?
113 HHSearch 79.7443% -66 - C3 -3X44 7.4 ?
94 PsiBlast_CBE 79.5543% -66 - C3 -3X44 7.4 ?
120 HHSearch 79.3538% -60 - C3 -3PC3 8.6 ?
93 PsiBlast_CBE 78.3843% -64 - C3 -3X44 7.1 ?
117 HHSearch 75.8736% -56 - C3 -3DWG 3.8 CYSM_MYCTU
68 PsiBlast_CBE 75.7342% -67 - C3 -2BHS 2.6 CYSM_ECOLI
51 PsiBlast_CBE 74.5648% -77 - C3 -4AIR 3.4 ?
67 PsiBlast_CBE 74.4542% -65 - C3 -2BHS 2.8 CYSM_ECOLI
65 PsiBlast_CBE 74.3042% -64 - C3 -2BHS 2.0 CYSM_ECOLI
66 PsiBlast_CBE 74.2742% -66 - C3 -2BHS 3.1 CYSM_ECOLI
8 PsiBlast_PDB 62.5367% 10 - C3 -3IQH Error CYSK_HAEIN
9 PsiBlast_PDB 59.5067% 11 - C3 -3IQI Error CYSK_HAEIN
7 PsiBlast_PDB 58.8667% 10 - C3 -3IQG Error CYSK_HAEIN
5 PsiBlast_PDB 57.8567% 14 - C3 -4ZU6 3.9 CYSK_HAEIN
11 PsiBlast_PDB 56.7567% 12 - C3 -4LI3 Error CYSK_HAEIN
12 PsiBlast_PDB 55.2267% 12 - C3 -4NU8 Error CYSK_HAEIN
14 PsiBlast_PDB 54.3367% 20 - C3 -4ZU1 0.8 CYSK_HAEIN
13 PsiBlast_PDB 54.1267% 12 - C3 -4ORE Error CYSK_HAEIN