@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3004: (2016-02-13 )
MSVYAIIGGTGLTQLEGLTLSESLPIETPYGAPSAPLQRGRYAGREVLFLARHGHPHRFPPHQVNYRANLWALKQAGAEAVIAVNAVGGIHAAMGTGHLCVPHQLIDYTSGREHTYFAGDIEHVTHIDFSHPYDEPLRQRLIEALRALGLAHSSHGVYACTQGPRLETVAEIARLERDGNDIVGMTGMPEAALARELDLPYACLALVVNPAAGKSAGIITMAEIEQALHDGIGKVREVLARVLAG

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RHB_A_2(4GLJ)
?
[Raw transfer]




NDS_G_7(1TCV)
?
[Raw transfer]




69 HHSearch 98.36100%-132 - C3 -3OZB - MTIP_PSEAE -
1 PsiBlast_PDB 98.36100%-132 - C3 -3OZB - MTIP_PSEAE -
23 PsiBlast_CBE 98.06100%-134 - C3 -3OZB - MTIP_PSEAE -
24 PsiBlast_CBE 97.86100%-130 - C3 -3OZB - MTIP_PSEAE -
25 PsiBlast_CBE 97.10100%-129 - C3 -3OZB - MTIP_PSEAE -
21 PsiBlast_CBE 96.58100%-130 - C3 -3OZB - MTIP_PSEAE -
22 PsiBlast_CBE 94.93100%-130 - C3 -3OZB - MTIP_PSEAE -
72 HHSearch 76.0836%-118 - C3 -2A8Y - MTAP_SULSO -
93 Fugue 73.7434%-111 - C3 -4L5C - ? -
70 HHSearch 73.7040%-116 - C3 -1WTA - MTAP_AERPE -
80 HHSearch 72.8732%-113 * C3 *1CB0 - MTAP_HUMAN -
3 PsiBlast_PDB 72.7840%-114 - C3 -1WTA - MTAP_AERPE -
34 PsiBlast_CBE 71.3437%-107 - C3 -2A8Y - MTAP_SULSO -
38 PsiBlast_CBE 71.3237%-106 - C3 -2A8Y - MTAP_SULSO -
30 PsiBlast_CBE 71.0137%-108 - C3 -3T94 - MTAP_SULSO -
36 PsiBlast_CBE 70.6237%-107 - C3 -2A8Y - MTAP_SULSO -
17 PsiBlast_PDB 70.5732%-114 - C3 -4L5C - ? -
32 PsiBlast_CBE 70.5637%-105 - C3 -2A8Y - MTAP_SULSO -
61 PsiBlast_CBE 70.5532%-114 - C3 -4L5C - ? -
39 PsiBlast_CBE 70.4237%-106 - C3 -2A8Y - MTAP_SULSO -
7 PsiBlast_PDB 63.8541%-110 - C3 -4GLJ 5.4 ?