@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3050: (2016-02-13 )
MYTLARQLLFKLSPETSHELSIDLIGAGGRLGLNRLLTPKPASLPVSVLGLEFPNPVGLAAGLDKNGDAIDGFGQLGFGFIEIGTVTPRPQPGNPRPRLFRLPQANAIINRMGFNNHGVDHLLARVRAAKYRGVLGINIGKNFDTPVERAVDDYLICLDKVYADASYVTVNVSSPNTPGLRSLQFGDSLKQLLEALRQRQEALALRHGRRVPLAIKIAPDMTDEETALVAAALVEAGMDAVIATNTTLGREGVEGLPHGDEAGGLSGAPVREKSTHTVKVLAGELGGRLPIIAAGGITEGAHAAEKIAAGASLVQIYSGFIYKGPALIREAVDAIAALPRRN

Atome Classification :

(55 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

FMN_H_8(2FPY)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2WV8)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JGD)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS1)
PYRD_HUMAN
[Raw transfer]




FMN_A_7(2FPT)
PYRD_HUMAN
[Raw transfer]




FMN_A_4(2BXV)
PYRD_HUMAN
[Raw transfer]




FMN_A_4(1TV5)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3G0U)
PYRD_HUMAN
[Raw transfer]




FMN_A_10(3W7R)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(1UUO)
PYRD_RAT
[Raw transfer]




FMN_A_2(4JTU)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3G)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVJ)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3ZWT)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVL)
PYRD_HUMAN
[Raw transfer]




FMN_A_4(1TV5)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3FJ6)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4ORI)
PYRD_RAT
[Raw transfer]




FMN_A_2(4LS2)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4JTS)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3G0X)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3FJL)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(3ZWS)
PYRD_HUMAN
[Raw transfer]




FMN_C_3(2B0M)
PYRD_HUMAN
[Raw transfer]




FMN_A_8(2FPV)
PYRD_HUMAN
[Raw transfer]




FMN_A_7(2FQI)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3G)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(1D3H)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(2PRH)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4OQV)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVK)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3KVM)
PYRD_HUMAN
[Raw transfer]




FMN_A_5(2PRL)
PYRD_HUMAN
[Raw transfer]




FMN_A_2(4LS0)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3I6R)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(4JS3)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4ORM)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQA)
PYRD_PLAF7
[Raw transfer]




FMN_B_7(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_3(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(4CQA)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(3F1Q)
PYRD_HUMAN
[Raw transfer]




FMN_B_6(4CQ8)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(1UUM)
PYRD_RAT
[Raw transfer]




FMN_A_2(4JTT)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(4CQ9)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(3U2O)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3I68)
PYRD_PLAF7
[Raw transfer]




FMN_B_6(4CQ9)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3I65)
PYRD_PLAF7
[Raw transfer]




FMN_A_3(3SFK)
PYRD_PLAF7
[Raw transfer]




FMN_A_2(2PRM)
PYRD_HUMAN
[Raw transfer]




FMN_A_3(3O8A)
PYRD_PLAF7
[Raw transfer]




AFI_B_9(1UUM)
PYRD_RAT
[Raw transfer]




AFI_A_5(1UUM)
PYRD_RAT
[Raw transfer]




DOR_A_4(3KVJ)
PYRD_HUMAN
[Raw transfer]




DOR_A_4(3KVK)
PYRD_HUMAN
[Raw transfer]




OXC_A_5(2E6F)
PYRD_TRYCC
[Raw transfer]




BRF_A_2(1UUO)
PYRD_RAT
[Raw transfer]




A26_A_3(1TV5)
PYRD_PLAF7
[Raw transfer]




2V6_A_2(4ORM)
PYRD_PLAF7
[Raw transfer]




65 HHSearch 92.0657% -88 - C1 -1F76 - PYRD_ECOLI -
1 PsiBlast_PDB 91.1856% -89 - C1 -1F76 - PYRD_ECOLI -
29 PsiBlast_CBE 79.3944% -82 - C1 -4JGD 10.5 PYRD_HUMAN
18 PsiBlast_PDB 78.9144% -79 - C1 -3U2O 10.2 PYRD_HUMAN
3 PsiBlast_PDB 78.8844% -85 - C1 -1UUO 8.7 PYRD_RAT
34 PsiBlast_CBE 77.3644% -81 - C1 -3KVJ 10.6 PYRD_HUMAN
24 PsiBlast_CBE 77.3444% -81 - C1 -4LS0 9.9 PYRD_HUMAN
22 PsiBlast_CBE 77.2944% -80 - C1 -4LS2 10.5 PYRD_HUMAN
33 PsiBlast_CBE 77.1844% -83 - C1 -3KVK 9.9 PYRD_HUMAN
20 PsiBlast_PDB 77.1344% -88 - C1 -4OQV 10.8 PYRD_HUMAN
6 PsiBlast_PDB 76.9744% -79 - C1 -1D3H 9.8 PYRD_HUMAN
8 PsiBlast_PDB 76.7844% -88 - C1 -2PRH 10.5 PYRD_HUMAN
26 PsiBlast_CBE 76.7744% -81 - C1 -4JTT 10.5 PYRD_HUMAN
15 PsiBlast_PDB 76.7744% -80 - C1 -3G0X 9.9 PYRD_HUMAN
27 PsiBlast_CBE 76.7544% -81 - C1 -4JTS 10.6 PYRD_HUMAN
32 PsiBlast_CBE 76.5944% -79 - C1 -3KVL 10.5 PYRD_HUMAN
21 PsiBlast_CBE 76.5544% -85 - C1 -1UUM 9.1 PYRD_RAT
2 PsiBlast_PDB 76.5544% -85 - C1 -1UUM 9.2 PYRD_RAT
25 PsiBlast_CBE 76.4344% -81 - C1 -4JTU 10.9 PYRD_HUMAN
30 PsiBlast_CBE 76.1744% -79 - C1 -3W7R 10.6 PYRD_HUMAN
35 PsiBlast_CBE 76.0544% -81 - C1 -2FQI 9.9 PYRD_HUMAN
14 PsiBlast_PDB 76.0244% -78 - C1 -3G0U 10.3 PYRD_HUMAN
31 PsiBlast_CBE 75.6844% -81 - C1 -3KVM 10.6 PYRD_HUMAN
12 PsiBlast_PDB 75.6644% -79 - C1 -3FJ6 10.4 PYRD_HUMAN
28 PsiBlast_CBE 75.3744% -80 - C1 -4JS3 10.8 PYRD_HUMAN
4 PsiBlast_PDB 75.2844% -82 - C1 -4ORI 9.5 PYRD_RAT
38 PsiBlast_CBE 75.2744% -79 - C1 -2FPT 9.7 PYRD_HUMAN
11 PsiBlast_PDB 75.1244% -76 - C1 -3F1Q 10.7 PYRD_HUMAN
13 PsiBlast_PDB 75.0444% -77 - C1 -3FJL 10.5 PYRD_HUMAN
17 PsiBlast_PDB 74.9644% -80 - C1 -3ZWT 10.6 PYRD_HUMAN
55 Fugue 74.9542% -84 - C1 -1D3G 10.7 PYRD_HUMAN
37 PsiBlast_CBE 74.6644% -77 - C1 -2FPV 9.8 PYRD_HUMAN
5 PsiBlast_PDB 74.4744% -80 - C1 -1D3G 10.7 PYRD_HUMAN
9 PsiBlast_PDB 74.3644% -79 - C1 -2PRL 10.7 PYRD_HUMAN
36 PsiBlast_CBE 74.3144% -79 - C1 -2FPY 10.0 PYRD_HUMAN
19 PsiBlast_PDB 74.2544% -76 - C1 -2B0M 9.3 PYRD_HUMAN
16 PsiBlast_PDB 74.1944% -80 - C1 -3ZWS 10.5 PYRD_HUMAN
23 PsiBlast_CBE 74.1144% -79 - C1 -4LS1 10.0 PYRD_HUMAN
7 PsiBlast_PDB 74.0444% -80 - C1 -2BXV 9.9 PYRD_HUMAN
10 PsiBlast_PDB 73.6844% -76 - C1 -2PRM 9.5 PYRD_HUMAN
39 PsiBlast_CBE 72.5044% -75 - C1 -2WV8 9.6 PYRD_HUMAN
64 HHSearch 72.2636% -79 * C1 *1TV5 9.4 PYRD_PLAF7
45 PsiBlast_CBE 62.7939% -84 - C1 -4CQ9 10.2 PYRD_PLAF7
44 PsiBlast_CBE 62.7539% -83 - C1 -4CQ9 10.4 PYRD_PLAF7
40 PsiBlast_CBE 62.1239% -87 - C1 -3SFK 8.8 PYRD_PLAF7
43 PsiBlast_CBE 61.8839% -82 - C1 -4CQA 10.4 PYRD_PLAF7
42 PsiBlast_CBE 61.8139% -84 - C1 -4CQA 10.5 PYRD_PLAF7
46 PsiBlast_CBE 60.8139% -81 - C1 -4CQ8 10.6 PYRD_PLAF7
47 PsiBlast_CBE 60.6139% -81 - C1 -4CQ8 10.9 PYRD_PLAF7
49 PsiBlast_CBE 60.2539% -79 - C1 -3O8A 9.6 PYRD_PLAF7
41 PsiBlast_CBE 60.0039% -77 - C1 -4ORM 10.6 PYRD_PLAF7
51 PsiBlast_CBE 59.3939% -77 - C1 -3I68 10.1 PYRD_PLAF7
52 PsiBlast_CBE 59.1639% -81 - C1 -3I65 10.7 PYRD_PLAF7
50 PsiBlast_CBE 58.9939% -77 - C1 -3I6R 9.8 PYRD_PLAF7
53 PsiBlast_CBE 58.1935% -78 - C1 -1TV5 9.4 PYRD_PLAF7