@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3314: (2016-02-15 )
MSLSLDGVDLVHADGQRALADIRLRLAAGERVALIGPSGAGKTSLLRVLASQWRPSAGRVELLGEEPWALSAAARQRLRARIGLVHQAPPLPPRQRVVSAVLAGRLGQWPLWKSLVSLVYPLDRAGAHDALQRLDLGDKLFQRCDQLSGGQLQRVGIARVLYQRAELILADEPVSAMDPVLAGHTLALLNREAAARGSTLLASLHAVDLALQHFPRVIGLRAGRIAFDLPAGEVDRAALDALYANEQLQAERASPAGEPAVMHIPRC

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

ATP_J_5(4YMU)
?
[Raw transfer]




ANP_J_5(3C41)
?
[Raw transfer]




ATP_J_5(4YMV)
?
[Raw transfer]




AGS_A_4(3C4J)
?
[Raw transfer]




ADP_A_5(2Q0H)
?
[Raw transfer]




ADP_A_2(4U00)
?
[Raw transfer]




AT4_A_5(2OLK)
?
[Raw transfer]




5 PsiBlast_PDB 89.4030%-111 - C1 -2Q0H 3.2 ?
4 PsiBlast_PDB 89.3730%-107 - C1 -2OUK - ? -
3 PsiBlast_PDB 89.2830%-109 - C1 -2OLK 4.5 ?
58 Fugue 87.7528%-103 - C1 -3TUZ - METN_ECOLI -
2 PsiBlast_PDB 87.5430%-110 - C1 -2OLJ - ? -
6 PsiBlast_PDB 87.4130%-112 - C1 -3C4J 5.0 ?
7 PsiBlast_PDB 86.6531%-114 - C1 -4U00 4.7 ?
1 PsiBlast_PDB 86.5630%-107 - C1 -3C41 5.5 ?
8 PsiBlast_PDB 82.0531%-110 - C1 -4U02 - ? -
22 PsiBlast_CBE 81.7731%-114 - C1 -4U02 - ? -
23 PsiBlast_CBE 81.4731%-111 - C1 -4U02 - ? -
67 HHSearch 81.2630% -97 * C1 *3TUI - METN_ECOLI -
21 PsiBlast_CBE 78.8131%-107 - C1 -4U02 - ? -
32 PsiBlast_CBE 77.9431%-106 - C1 -4G1U - HMUV_YERPE -
61 Fugue 77.6927%-105 - C1 -1Z47 - ? -
20 PsiBlast_PDB 77.5532%-104 - C1 -3TUI - METN_ECOLI -
31 PsiBlast_CBE 76.7131%-106 - C1 -4G1U - HMUV_YERPE -
11 PsiBlast_PDB 74.9430%-120 - C1 -4YMU 5.5 ?
29 PsiBlast_CBE 74.4132%-107 - C1 -3TUI - METN_ECOLI -
78 HHSearch 73.9226%-103 - C1 -3GFO - ECFA3_CLOP1 -
12 PsiBlast_PDB 68.9030%-123 - C1 -4YMV 3.5 ?