@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3650: (2016-02-19 )
MSRPQRISVLGATGSIGLSTLDVVQRHPDRYEAFALTGFSRLAELEALCLRHRPVYAVVPEQAAAIALQGSLAAAGIRTRVLFGEQALCEVASAPEVDMVMAAIVGAAGLPSTLAAVEAGKRVLLANKEALVMSGALFMQAVKRSGAVLLPIDSEHNAIFQSLPRNYADGLERVGVRRILLTASGGPFRETPLEQLASVTPEQACAHPNWSMGRKISVDSASMMNKGLELIEACWLFDAQPSQVEVVIHPQSVIHSMVDYVDGSVIAQLGNPDMRTPISYAMAWPERIDSGVSPLDMFAVGRLDFQRPDEQRFPCLRLASQAAETGGSAPAMLNAANEVAVAAFLERHIRFSDIAVIIEDVLNREAVTAVESLDQVLAADRRARSVAGQWLTRHAG

Atome Classification :

(72 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

DXP_B_4(1Q0Q)
DXR_ECOLI
[Raw transfer]




DXP_A_3(1Q0Q)
DXR_ECOLI
[Raw transfer]




RF7_B_6(4Y6R)
DXR_PLAF7
[Raw transfer]




RF7_A_3(4Y6R)
DXR_PLAF7
[Raw transfer]




48S_A_4(4Y6S)
DXR_PLAF7
[Raw transfer]




R77_A_3(4Y6P)
DXR_PLAF7
[Raw transfer]




R77_B_5(4Y6P)
DXR_PLAF7
[Raw transfer]




C0K_A_4(3R0I)
DXR_ECOLI
[Raw transfer]




1UQ_B_7(4KP7)
DXR_PLAFX
[Raw transfer]




48S_B_6(4Y6S)
DXR_PLAF7
[Raw transfer]




RC5_B_5(4Y67)
DXR_PLAF7
[Raw transfer]




RC5_A_3(4Y67)
DXR_PLAF7
[Raw transfer]




F98_B_8(4A03)
DXR_MYCTU
[Raw transfer]




F98_A_4(4A03)
DXR_MYCTU
[Raw transfer]




C0K_B_6(3R0I)
DXR_ECOLI
[Raw transfer]




CBQ_A_6(1T1S)
DXR_ECOLI
[Raw transfer]




FOM_A_5(2EGH)
DXR_ECOLI
[Raw transfer]




IMB_E_5(1T1R)
DXR_ECOLI
[Raw transfer]




FM5_A_3(2Y1G)
DXR_MYCTU
[Raw transfer]




FOM_A_5(1ONP)
DXR_ECOLI
[Raw transfer]




FOM_B_6(1ONP)
DXR_ECOLI
[Raw transfer]




FM7_A_3(3ZHZ)
DXR_MYCTU
[Raw transfer]




34F_A_3(2Y1F)
DXR_MYCTU
[Raw transfer]




34F_A_3(2Y1D)
DXR_MYCTU
[Raw transfer]




CBQ_B_7(1T1S)
DXR_ECOLI
[Raw transfer]




FM6_A_4(3ZHX)
DXR_MYCTU
[Raw transfer]




IMB_F_6(1T1R)
DXR_ECOLI
[Raw transfer]




FM8_A_3(3ZI0)
DXR_MYCTU
[Raw transfer]




NAP_A_4(4KP7)
DXR_PLAFX
[Raw transfer]




NDP_A_5(1Q0Q)
DXR_ECOLI
[Raw transfer]




NDP_B_6(3WQQ)
DXR_PLAFX
[Raw transfer]




NDP_A_3(3AU9)
DXR_PLAFX
[Raw transfer]




NDP_A_4(2Y1F)
DXR_MYCTU
[Raw transfer]




NDP_B_6(3AU9)
DXR_PLAFX
[Raw transfer]




NDP_A_5(4A03)
DXR_MYCTU
[Raw transfer]




NDP_A_3(3WQR)
DXR_PLAFX
[Raw transfer]




NDP_B_2(3WQS)
DXR_PLAFX
[Raw transfer]




NDP_A_4(4AIC)
DXR_MYCTU
[Raw transfer]




NDP_B_6(3WQR)
DXR_PLAFX
[Raw transfer]




NDP_E_5(1Q0L)
DXR_ECOLI
[Raw transfer]




NDP_B_6(1Q0Q)
DXR_ECOLI
[Raw transfer]




NDP_A_5(1Q0Q)
DXR_ECOLI
[Raw transfer]




NDP_A_3(4GAE)
DXR_PLAFX
[Raw transfer]




NDP_B_8(3ZHY)
DXR_MYCTU
[Raw transfer]




DE2_A_5(4RCV)
?
[Raw transfer]




NDP_B_9(4A03)
DXR_MYCTU
[Raw transfer]




NDP_B_6(3AUA)
DXR_PLAFX
[Raw transfer]




NDP_B_10(4GAE)
DXR_PLAFX
[Raw transfer]




NDP_A_3(3AUA)
DXR_PLAFX
[Raw transfer]




NDP_A_3(3A06)
DXR_THEMA
[Raw transfer]




NDP_A_3(3WQQ)
DXR_PLAFX
[Raw transfer]




NDP_A_5(3ZHY)
DXR_MYCTU
[Raw transfer]




NDP_B_8(2EGH)
DXR_ECOLI
[Raw transfer]




NDP_A_4(4RCV)
?
[Raw transfer]




NDP_B_9(4AIC)
DXR_MYCTU
[Raw transfer]




NDP_B_6(2JCV)
DXR_MYCTU
[Raw transfer]




NDP_A_4(2JCX)
DXR_MYCTU
[Raw transfer]




NDP_A_3(2JD1)
DXR_MYCTU
[Raw transfer]




NDP_A_4(2JCV)
DXR_MYCTU
[Raw transfer]




NDP_A_3(2JD0)
DXR_MYCTU
[Raw transfer]




NDP_B_9(2Y1F)
DXR_MYCTU
[Raw transfer]




NDP_A_3(3RAS)
DXR_MYCTU
[Raw transfer]




NDP_B_6(3ANM)
DXR_ECOLI
[Raw transfer]




NDP_A_3(3ANN)
DXR_ECOLI
[Raw transfer]




NDP_B_5(3ANN)
DXR_ECOLI
[Raw transfer]




NDP_A_3(1Q0H)
DXR_ECOLI
[Raw transfer]




NDP_A_7(2EGH)
DXR_ECOLI
[Raw transfer]




NDP_B_6(2JCX)
DXR_MYCTU
[Raw transfer]




NDP_A_3(3ANL)
DXR_ECOLI
[Raw transfer]




NDP_A_4(3ANM)
DXR_ECOLI
[Raw transfer]




NDP_B_5(3ANL)
DXR_ECOLI
[Raw transfer]




NDP_B_6(3RAS)
DXR_MYCTU
[Raw transfer]




NDP_B_5(3AU8)
DXR_PLAFX
[Raw transfer]




NDP_A_5(1JVS)
DXR_ECOLI
[Raw transfer]




NDP_B_8(4RCV)
?
[Raw transfer]




10 PsiBlast_PDB 97.2657%-115 - C1 -3R0I 3.6 DXR_ECOLI
15 PsiBlast_PDB 97.1357%-117 - C1 -3IIE - DXR_YERPY -
4 PsiBlast_PDB 97.0657%-111 - C1 -1T1R 3.5 DXR_ECOLI
32 PsiBlast_CBE 96.7257%-119 - C1 -3IIE - DXR_YERPY -
21 PsiBlast_CBE 96.6057%-117 - C1 -4ZN6 - DXR_ACIB3 -
29 PsiBlast_CBE 96.3657%-111 - C1 -3ANM 10.0 DXR_ECOLI
5 PsiBlast_PDB 96.1857%-112 - C1 -1T1S 3.0 DXR_ECOLI
27 PsiBlast_CBE 96.1357%-115 - C1 -3R0I 3.7 DXR_ECOLI
1 PsiBlast_PDB 96.1257%-115 - C1 -4ZN6 - DXR_ACIB3 -
24 PsiBlast_CBE 96.1057%-109 - C1 -1T1R 4.1 DXR_ECOLI
23 PsiBlast_CBE 96.0457%-109 - C1 -1T1S 3.2 DXR_ECOLI
11 PsiBlast_PDB 95.7757%-110 - C1 -3ANL 10.9 DXR_ECOLI
13 PsiBlast_PDB 95.6157%-110 - C1 -3ANN 10.2 DXR_ECOLI
17 PsiBlast_PDB 95.1255%-110 - C1 -1JVS 8.8 DXR_ECOLI
14 PsiBlast_PDB 95.1057%-109 - C1 -2EGH 7.7 DXR_ECOLI
111 HHSearch 94.8358%-106 - C1 -1Q0Q 10.8 DXR_ECOLI
30 PsiBlast_CBE 94.7757%-109 - C1 -3ANL 9.9 DXR_ECOLI
31 PsiBlast_CBE 94.6457%-110 - C1 -2EGH 6.8 DXR_ECOLI
28 PsiBlast_CBE 94.6357%-109 - C1 -3ANN 9.6 DXR_ECOLI
22 PsiBlast_CBE 94.6157%-109 - C1 -1Q0Q 10.8 DXR_ECOLI
12 PsiBlast_PDB 94.5557%-108 - C1 -3ANM 10.4 DXR_ECOLI
9 PsiBlast_PDB 93.2257%-111 - C1 -1ONP 2.9 DXR_ECOLI
3 PsiBlast_PDB 93.1957%-106 - C1 -1Q0Q 10.8 DXR_ECOLI
2 PsiBlast_PDB 92.7657%-104 - C1 -1Q0L 11.0 DXR_ECOLI
25 PsiBlast_CBE 92.6057%-109 - C1 -1ONP 3.2 DXR_ECOLI
16 PsiBlast_PDB 92.3855%-106 - C1 -1Q0H 6.8 DXR_ECOLI
47 PsiBlast_CBE 82.5334%-115 - C1 -3AU8 9.0 DXR_PLAFX
52 PsiBlast_CBE 80.8934%-108 - C1 -4Y6R 7.1 DXR_PLAF7
50 PsiBlast_CBE 80.8934%-107 - C1 -4Y6S 7.0 DXR_PLAF7
51 PsiBlast_CBE 80.8634%-110 - C1 -4Y6S 7.1 DXR_PLAF7
57 PsiBlast_CBE 80.8534%-110 - C1 -4Y67 7.0 DXR_PLAF7
43 PsiBlast_CBE 80.7334%-108 - C1 -3WQQ 11.1 DXR_PLAFX
20 PsiBlast_PDB 80.2734%-107 - C1 -3AU9 11.3 DXR_PLAFX
53 PsiBlast_CBE 80.2034%-109 - C1 -4Y6R 6.6 DXR_PLAF7
54 PsiBlast_CBE 80.0534%-106 - C1 -4Y6P 7.2 DXR_PLAF7
56 PsiBlast_CBE 79.9434%-108 - C1 -4Y67 7.3 DXR_PLAF7
59 PsiBlast_CBE 79.9034%-108 - C1 -4GAE 11.7 DXR_PLAFX
55 PsiBlast_CBE 79.8934%-105 - C1 -4Y6P 7.3 DXR_PLAF7
49 PsiBlast_CBE 79.6734%-109 - C1 -4KP7 11.3 DXR_PLAFX
48 PsiBlast_CBE 79.4734%-112 - C1 -4KP7 4.5 DXR_PLAFX
44 PsiBlast_CBE 79.3134%-105 - C1 -3AUA 11.8 DXR_PLAFX
42 PsiBlast_CBE 79.2734%-105 - C1 -3WQQ 12.0 DXR_PLAFX
41 PsiBlast_CBE 79.1334%-106 - C1 -3WQR 11.3 DXR_PLAFX
45 PsiBlast_CBE 79.0234%-103 - C1 -3AUA 11.2 DXR_PLAFX
39 PsiBlast_CBE 79.0034%-107 - C1 -3WQS 12.2 DXR_PLAFX
40 PsiBlast_CBE 78.9934%-105 - C1 -3WQR 11.0 DXR_PLAFX
46 PsiBlast_CBE 78.6634%-103 - C1 -3AU9 11.6 DXR_PLAFX
58 PsiBlast_CBE 78.1034%-107 - C1 -4GAE 11.5 DXR_PLAFX
60 PsiBlast_CBE 77.4344%-109 - C1 -4AIC 7.6 DXR_MYCTU
97 PsiBlast_CBE 77.1943%-109 - C1 -2JCX 8.5 DXR_MYCTU
80 PsiBlast_CBE 77.1644%-107 - C1 -2JCV 9.6 DXR_MYCTU
64 PsiBlast_CBE 76.0644%-105 - C1 -3RAS 10.1 DXR_MYCTU
91 PsiBlast_CBE 75.9644%-106 - C1 -4RCV 4.6 ?
62 PsiBlast_CBE 75.9044%-103 - C1 -4A03 10.6 DXR_MYCTU
68 PsiBlast_CBE 75.4644%-105 - C1 -2Y1F 7.6 DXR_MYCTU
94 PsiBlast_CBE 75.0443%-104 - C1 -2JD0 8.3 DXR_MYCTU
63 PsiBlast_CBE 74.8744%-103 - C1 -4A03 10.5 DXR_MYCTU
79 PsiBlast_CBE 74.8644%-101 - C1 -2JD1 9.4 DXR_MYCTU
98 PsiBlast_CBE 74.8443%-103 - C1 -2JCX 9.6 DXR_MYCTU
67 PsiBlast_CBE 74.6244%-104 - C1 -2Y1G 5.6 DXR_MYCTU
61 PsiBlast_CBE 74.4944%-103 - C1 -4AIC 9.8 DXR_MYCTU
90 PsiBlast_CBE 73.9744%-103 - C1 -3ZHX 5.5 DXR_MYCTU
69 PsiBlast_CBE 73.8844%-104 - C1 -2Y1F 9.6 DXR_MYCTU
65 PsiBlast_CBE 73.8744%-106 - C1 -3RAS 10.6 DXR_MYCTU
81 PsiBlast_CBE 73.8344%-100 - C1 -2JCV 10.8 DXR_MYCTU
92 PsiBlast_CBE 73.4744%-105 - C1 -4RCV 8.4 ?
73 PsiBlast_CBE 73.1744%-110 - C1 -2Y1D 4.1 DXR_MYCTU
87 PsiBlast_CBE 72.7844%-102 - C1 -3ZHY 8.8 DXR_MYCTU
86 PsiBlast_CBE 72.5344%-105 - C1 -3ZHZ 5.8 DXR_MYCTU
88 PsiBlast_CBE 72.4044%-102 - C1 -3ZHY 9.1 DXR_MYCTU
85 PsiBlast_CBE 71.6544%-107 - C1 -3ZI0 5.1 DXR_MYCTU
114 HHSearch 71.4835%-104 - C1 -3A06 9.7 DXR_THEMA