@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3724: (2016-02-20 )
MKKVSTLDLLFVAIMGVSPAAFAADLIDVSKLPSKAAQGAPGPVTLQAAVGAGGADELKAIRSTTLPNGKQVTRYEQFHNGVRVVGEAITEVKGPGKSVAAQRSGHFVANIAADLPGSTTAAVSAEQVLAQAKSLKAQGRKTENDKVELVIRLGENNIAQLVYNVSYLIPGEGLSRPHFVIDAKTGEVLDQWEGLAHAEAGGPGGNQKIGKYTYGSDYGPLIVNDRCEMDDGNVITVDMNSSTDDSKTTPFRFACPTNTYKQVNGAYSPLNDAHFFGGVVFKLYRDWFGTSPLTHKLYMKVHYGRSVENAYWDGTAMLFGDGATMFYPLVSLDVAAHEVSHGFTEQNSGLIYRGQSGGMNEAFSDMAGEAAEFYMRGKNDFLIGYDIKKGSGALRYMDQPSRDGRSIDNASQYYNGIDVHHSSGVYNRAFYLLANSPGWDTRKAFEVFVDANRYYWTATSNYNSGACGVIRSAQNRNYSAADVTRAFSTVGVTCPSAL

Atome Classification :

(86 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

RDF_A_7(3DBK)
ELAS_PSEAE
[Raw transfer]




HPI_A_5(1U4G)
ELAS_PSEAE
[Raw transfer]




0PK_E_2(4TMN)
THER_BACTH
[Raw transfer]




RDF_E_2(1TLP)
THER_BACTH
[Raw transfer]




UBT_A_2(3T8G)
THER_BACTH
[Raw transfer]




0PJ_E_2(5TMN)
THER_BACTH
[Raw transfer]




UBV_A_2(3T8D)
THER_BACTH
[Raw transfer]




UBZ_A_2(3T87)
THER_BACTH
[Raw transfer]




BAN_A_7(5TLN)
THER_BACTH
[Raw transfer]




UBS_A_2(3T8H)
THER_BACTH
[Raw transfer]




UBW_A_2(3T8C)
THER_BACTH
[Raw transfer]




0PJ_A_7(4H57)
THER_BACTH
[Raw transfer]




0PI_E_2(6TMN)
THER_BACTH
[Raw transfer]




0PQ_A_7(1OS0)
THER_BACTH
[Raw transfer]




0ZN_E_2(1TMN)
THER_BACTH
[Raw transfer]




0FA_E_7(2TMN)
THER_BACTH
[Raw transfer]




2G6_E_13(4N4E)
THER_BACTH
[Raw transfer]




UBY_A_2(3T74)
THER_BACTH
[Raw transfer]




NX6_A_9(3QH5)
THER_BACTH
[Raw transfer]




2G6_E_7(4OI5)
THER_BACTH
[Raw transfer]




NX6_A_7(3QH1)
THER_BACTH
[Raw transfer]




UBX_A_2(3T73)
THER_BACTH
[Raw transfer]




0DB_A_7(1THL)
THER_BACTH
[Raw transfer]




2G8_E_12(4MXJ)
THER_BACTH
[Raw transfer]




2GC_E_14(4MWP)
THER_BACTH
[Raw transfer]




TI1_A_7(1QF1)
THER_BACTH
[Raw transfer]




M3S_A_7(3FCQ)
THER_BACTH
[Raw transfer]




TI2_A_7(1QF0)
THER_BACTH
[Raw transfer]




2G9_E_13(4MZN)
THER_BACTH
[Raw transfer]




2GZ_E_14(4N66)
THER_BACTH
[Raw transfer]




TI3_A_7(1QF2)
THER_BACTH
[Raw transfer]




S7B_A_7(3F28)
THER_BACTH
[Raw transfer]




UBU_A_2(3T8F)
THER_BACTH
[Raw transfer]




TIO_E_7(1ZDP)
THER_BACTH
[Raw transfer]




BZS_A_8(1HYT)
THER_BACTH
[Raw transfer]




2H0_E_13(4N5P)
THER_BACTH
[Raw transfer]




2G7_E_13(4MTW)
THER_BACTH
[Raw transfer]




INC_A_7(7TLN)
THER_BACTH
[Raw transfer]




LNO_A_7(4TLN)
THER_BACTH
[Raw transfer]




ZNP_A_8(3FOR)
THER_BACTH
[Raw transfer]




RRT_E_7(1Z9G)
THER_BACTH
[Raw transfer]




BET_E_16(3T2J)
THER_BACTH
[Raw transfer]




S3B_A_6(3F2P)
THER_BACTH
[Raw transfer]




IPH_A_8(1FJW)
THER_BACTH
[Raw transfer]




GOL_A_10(3MSF)
THER_BACTH
[Raw transfer]




PGO_A_7(3N21)
THER_BACTH
[Raw transfer]




IPA_A_8(7TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(6TLI)
THER_BACTH
[Raw transfer]




ACN_A_8(1FJ3)
THER_BACTH
[Raw transfer]




IPA_A_8(3TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(4TLI)
THER_BACTH
[Raw transfer]




0A9_A_7(3QGO)
THER_BACTH
[Raw transfer]




IPA_A_8(2TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(8TLI)
THER_BACTH
[Raw transfer]




IPA_A_8(5TLI)
THER_BACTH
[Raw transfer]




ACN_A_8(1FJO)
THER_BACTH
[Raw transfer]




ACN_A_8(1FJQ)
THER_BACTH
[Raw transfer]




DMS_A_2(4D91)
THER_BACTH
[Raw transfer]




BXA_A_7(3NN7)
THER_BACTH
[Raw transfer]




LYS_A_3(1GXW)
THER_BACTH
[Raw transfer]




LYS_A_3(2TLX)
THER_BACTH
[Raw transfer]




LYS_A_9(1FJT)
THER_BACTH
[Raw transfer]




LYS_E_3(1LNB)
THER_BACTH
[Raw transfer]




TRP_E_3(3TMN)
THER_BACTH
[Raw transfer]




LYS_E_3(8TLN)
THER_BACTH
[Raw transfer]




BR3_A_7(1PE5)
THER_BACTH
[Raw transfer]




CCN_A_8(1FJU)
THER_BACTH
[Raw transfer]




NMU_A_7(3MSN)
THER_BACTH
[Raw transfer]




BR5_A_7(1PE8)
THER_BACTH
[Raw transfer]




LYS_E_3(1LNC)
THER_BACTH
[Raw transfer]




4BR_A_7(1PE7)
THER_BACTH
[Raw transfer]




LYS_E_3(1LND)
THER_BACTH
[Raw transfer]




LYS_E_3(1LNE)
THER_BACTH
[Raw transfer]




LYS_E_3(1LNF)
THER_BACTH
[Raw transfer]




ACY_E_11(2A7G)
THER_BACTH
[Raw transfer]




LYS_E_3(1LNA)
THER_BACTH
[Raw transfer]




LYS_A_3(3ZI6)
THER_BACTH
[Raw transfer]




VAL_A_2(1TLX)
THER_BACTH
[Raw transfer]




TMO_E_19(3T2H)
THER_BACTH
[Raw transfer]




DMS_A_8(1QF0)
THER_BACTH
[Raw transfer]




3 PsiBlast_PDB 99.70100% -72 - C12 -3DBK 6.6 ELAS_PSEAE
1 PsiBlast_PDB 99.67100% -74 - C12 -1U4G 7.4 ELAS_PSEAE
2 PsiBlast_PDB 99.47100% -73 - C12 -1EZM - ELAS_PSEAE -
4 PsiBlast_PDB 98.6699% -71 - C12 -4K89 - ? -
111 HHSearch 87.5360% -71 - C12 -3NQX - ? -
5 PsiBlast_PDB 87.4260% -69 - C12 -3NQX - ? -
7 PsiBlast_PDB 86.5560% -69 - C12 -3NQZ - ? -
6 PsiBlast_PDB 86.2360% -68 - C12 -3NQY - ? -
67 PsiBlast_CBE 72.0433% -59 - C12 -1FJW 2.7 THER_BACTH
26 PsiBlast_CBE 72.0333% -60 - C12 -5TLI 2.7 THER_BACTH
23 PsiBlast_CBE 72.0133% -58 - C12 -7TLI 2.7 THER_BACTH
27 PsiBlast_CBE 71.9733% -56 - C12 -4TLN 2.9 THER_BACTH
11 PsiBlast_PDB 71.9233% -59 - C12 -4TMN 7.5 THER_BACTH
71 PsiBlast_CBE 71.8933% -61 - C12 -1FJQ 2.9 THER_BACTH
28 PsiBlast_CBE 71.8533% -62 - C12 -4TLI 2.6 THER_BACTH
80 PsiBlast_CBE 71.8433% -58 - C12 -4MWP 5.2 THER_BACTH
83 PsiBlast_CBE 71.8233% -60 - C12 -4D91 3.7 THER_BACTH
57 PsiBlast_CBE 71.8133% -57 - C12 -1QF2 6.2 THER_BACTH
33 PsiBlast_CBE 71.7833% -60 - C12 -3T2I - THER_BACTH -
13 PsiBlast_PDB 71.7733% -59 - C12 -6TMN 6.1 THER_BACTH
22 PsiBlast_CBE 71.7233% -59 - C12 -7TLN 3.0 THER_BACTH
84 PsiBlast_CBE 71.7033% -55 - C12 -3T8H 6.4 THER_BACTH
56 PsiBlast_CBE 71.6933% -59 - C12 -1THL 5.9 THER_BACTH
76 PsiBlast_CBE 71.6533% -57 - C12 -4N5P 5.1 THER_BACTH
32 PsiBlast_CBE 71.6533% -58 - C12 -3T2J 2.2 THER_BACTH
100 PsiBlast_CBE 71.6433% -57 - C12 -3MSF 2.2 THER_BACTH
94 PsiBlast_CBE 71.5933% -57 - C12 -3QH5 3.2 THER_BACTH
72 PsiBlast_CBE 71.6033% -59 - C12 -1FJO 2.8 THER_BACTH
82 PsiBlast_CBE 71.5933% -56 - C12 -4H57 6.1 THER_BACTH
25 PsiBlast_CBE 71.6033% -54 - C12 -5TLN 4.8 THER_BACTH
17 PsiBlast_PDB 71.5933% -57 - C12 -1LNB 2.7 THER_BACTH
95 PsiBlast_CBE 71.5833% -57 * C12 *3QH1 4.0 THER_BACTH
98 PsiBlast_CBE 71.5633% -58 - C12 -3N21 2.5 THER_BACTH
48 PsiBlast_CBE 71.5433% -59 - C12 -2TLX 2.5 THER_BACTH
21 PsiBlast_CBE 71.5333% -60 - C12 -8TLI 2.7 THER_BACTH
46 PsiBlast_CBE 71.5233% -58 - C12 -3F28 3.5 THER_BACTH
49 PsiBlast_CBE 71.5133% -61 - C12 -2TLI 2.6 THER_BACTH
15 PsiBlast_PDB 71.5033% -58 - C12 -1LNE 2.7 THER_BACTH
14 PsiBlast_PDB 71.5033% -57 - C12 -8TLN 2.8 THER_BACTH
10 PsiBlast_PDB 71.5033% -58 - C12 -2TMN 3.5 THER_BACTH
89 PsiBlast_CBE 71.4933% -56 - C12 -3T87 6.5 THER_BACTH
45 PsiBlast_CBE 71.4733% -58 - C12 -3F2P 3.5 THER_BACTH
18 PsiBlast_PDB 71.4733% -58 - C12 -1LNC 2.8 THER_BACTH
78 PsiBlast_CBE 71.4433% -57 - C12 -4MZN 6.2 THER_BACTH
77 PsiBlast_CBE 71.4433% -57 - C12 -4N4E 6.0 THER_BACTH
70 PsiBlast_CBE 71.4533% -60 - C12 -1FJT 2.5 THER_BACTH
30 PsiBlast_CBE 71.4433% -59 - C12 -3TMN 3.7 THER_BACTH
87 PsiBlast_CBE 71.4133% -56 - C12 -3T8D 6.8 THER_BACTH
99 PsiBlast_CBE 71.3933% -58 - C12 -3MSN 3.6 THER_BACTH
24 PsiBlast_CBE 71.4133% -59 - C12 -6TLI 2.7 THER_BACTH
79 PsiBlast_CBE 71.4033% -57 - C12 -4MXJ 6.1 THER_BACTH
51 PsiBlast_CBE 71.3933% -57 - C12 -2A7G 3.9 THER_BACTH
52 PsiBlast_CBE 71.3833% -60 - C12 -1ZDP 4.7 THER_BACTH
85 PsiBlast_CBE 71.3633% -56 - C12 -3T8G 6.3 THER_BACTH
65 PsiBlast_CBE 71.3633% -56 - C12 -1HYT 3.9 THER_BACTH
58 PsiBlast_CBE 71.3633% -55 - C12 -1QF1 7.2 THER_BACTH
81 PsiBlast_CBE 71.3533% -57 - C12 -4MTW 5.8 THER_BACTH
8 PsiBlast_PDB 71.3433% -60 - C12 -1TLP 5.2 THER_BACTH
90 PsiBlast_CBE 71.3233% -56 - C12 -3T74 6.1 THER_BACTH
96 PsiBlast_CBE 71.2933% -56 - C12 -3QGO 4.2 THER_BACTH
20 PsiBlast_PDB 71.3333% -57 - C12 -1QF0 8.7 THER_BACTH
54 PsiBlast_CBE 71.3233% -58 - C12 -1TLX 4.3 THER_BACTH
61 PsiBlast_CBE 71.3133% -58 - C12 -1PE5 2.9 THER_BACTH
69 PsiBlast_CBE 71.2933% -58 - C12 -1FJU 2.3 THER_BACTH
16 PsiBlast_PDB 71.2833% -58 - C12 -1LNF 3.0 THER_BACTH
73 PsiBlast_CBE 71.2633% -58 - C12 -1FJ3 2.8 THER_BACTH
62 PsiBlast_CBE 71.2533% -57 - C12 -1OS0 6.3 THER_BACTH
53 PsiBlast_CBE 71.2533% -59 - C12 -1Z9G 4.6 THER_BACTH
75 PsiBlast_CBE 71.2233% -56 - C12 -4N66 5.6 THER_BACTH
66 PsiBlast_CBE 71.2233% -56 - C12 -1GXW 2.9 THER_BACTH
31 PsiBlast_CBE 71.2233% -59 - C12 -3TLI 2.7 THER_BACTH
34 PsiBlast_CBE 71.2133% -59 - C12 -3T2H 2.4 THER_BACTH
59 PsiBlast_CBE 71.2033% -57 - C12 -1PE8 2.8 THER_BACTH
60 PsiBlast_CBE 71.1733% -57 - C12 -1PE7 3.5 THER_BACTH
29 PsiBlast_CBE 71.1533% -58 - C12 -3ZI6 2.6 THER_BACTH
97 PsiBlast_CBE 71.1333% -56 - C12 -3NN7 2.2 THER_BACTH
74 PsiBlast_CBE 71.1233% -59 - C12 -4OI5 6.3 THER_BACTH
12 PsiBlast_PDB 71.1133% -59 - C12 -5TMN 6.0 THER_BACTH
88 PsiBlast_CBE 71.1033% -56 - C12 -3T8C 7.0 THER_BACTH
44 PsiBlast_CBE 71.0733% -56 - C12 -3FCQ 3.1 THER_BACTH
86 PsiBlast_CBE 71.0533% -56 - C12 -3T8F 5.7 THER_BACTH
91 PsiBlast_CBE 71.0133% -58 - C12 -3T73 5.3 THER_BACTH
63 PsiBlast_CBE 71.0133% -56 - C12 -1LNA 2.9 THER_BACTH
19 PsiBlast_PDB 71.0133% -56 - C12 -1LND 2.9 THER_BACTH
43 PsiBlast_CBE 70.9433% -58 - C12 -3FOR 2.6 THER_BACTH
9 PsiBlast_PDB 70.7733% -58 - C12 -1TMN 7.6 THER_BACTH