@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3816: (2016-02-21 )
MFERVREDIQSVFHRDPAARNALEVLTCYPGLHAVWLHRLAHGLWTSGWKWLARLVSNFGRWMTGIEIHPGARIGRRFFIDHGMGIVIGETAEIGDDVTLYQGVTLGGTTWNKGKRHPTLGNNVVVGAGAKVLGPFTVGEGAKVGSNAVVTKEVPPGATVVGIPGRIIMREDSEQQAKRQAMAEKLGFDAYGVSQDMPDPVARAIGQLLDHLQAVDGRLEGMCQALTALGSDYCAKDLPVLREEDFAGVKDEDGNPAA

Atome Classification :

(27 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CYS_A_4(4H7O)
?
[Raw transfer]




CYS_A_6(4H7O)
?
[Raw transfer]




CYS_B_4(1T3D)
CYSE_ECOLI
[Raw transfer]




CYS_B_8(4H7O)
?
[Raw transfer]




SER_B_5(4N69)
?
[Raw transfer]




SER_A_3(4N69)
?
[Raw transfer]




COA_I_9(1SST)
CYSE_HAEIN
[Raw transfer]




COA_G_7(1SST)
CYSE_HAEIN
[Raw transfer]




COA_K_11(1SST)
CYSE_HAEIN
[Raw transfer]




ACO_A_7(3MQG)
?
[Raw transfer]




SER_A_2(3Q1X)
?
[Raw transfer]




SER_A_2(3Q1X)
?
[Raw transfer]




CYS_A_2(3P47)
?
[Raw transfer]




COA_K_11(1SST)
CYSE_HAEIN
[Raw transfer]




COA_I_9(1SST)
CYSE_HAEIN
[Raw transfer]




CYS_B_8(4H7O)
?
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




CYS_A_5(1SSQ)
CYSE_HAEIN
[Raw transfer]




125 Fugue 93.0443%-115 - C1 -1SSQ 3.7 CYSE_HAEIN
21 PsiBlast_CBE 80.8947%-116 - C1 -4H7O 2.7 ?
132 HHSearch 80.5843%-114 * C1 *1SSQ 3.7 CYSE_HAEIN
1 PsiBlast_PDB 79.3447%-112 - C1 -4H7O 2.8 ?
22 PsiBlast_CBE 78.6947%-112 - C1 -4H7O 3.6 ?
36 PsiBlast_CBE 78.6644%-124 - C1 -1SST 4.9 CYSE_HAEIN
4 PsiBlast_PDB 78.5344%-117 - C1 -1SSQ - CYSE_HAEIN -
44 PsiBlast_CBE 78.3942%-111 - C1 -3GVD - ? -
35 PsiBlast_CBE 78.2644%-110 - C1 -1SSQ 3.6 CYSE_HAEIN
47 PsiBlast_CBE 78.2042%-115 - C1 -3GVD - ? -
2 PsiBlast_PDB 78.0843%-124 - C1 -4HZD - ? -
10 PsiBlast_PDB 77.9942%-111 - C1 -3GVD - ? -
48 PsiBlast_CBE 77.9142%-107 - C1 -3GVD - ? -
38 PsiBlast_CBE 77.9042%-111 - C1 -3GVD - ? -
46 PsiBlast_CBE 77.6842%-109 - C1 -3GVD - ? -
5 PsiBlast_PDB 77.4744%-130 - C1 -1SST 3.8 CYSE_HAEIN
39 PsiBlast_CBE 77.4642%-110 - C1 -3GVD - ? -
53 PsiBlast_CBE 76.9543%-128 - C1 -4N6B - ? -
3 PsiBlast_PDB 76.8943%-120 - C1 -4HZC - ? -
37 PsiBlast_CBE 76.8844%-124 - C1 -1SST 4.9 CYSE_HAEIN
7 PsiBlast_PDB 76.8745%-120 - C1 -1T3D 3.5 CYSE_ECOLI
11 PsiBlast_PDB 75.1643%-121 - C1 -4N69 3.5 ?
133 HHSearch 75.0739%-123 - C1 -3Q1X 2.5 ?
55 PsiBlast_CBE 74.9943%-124 - C1 -4N69 3.5 ?
14 PsiBlast_PDB 74.4240%-123 - C1 -3P47 2.9 ?
16 PsiBlast_PDB 73.9740%-128 - C1 -3Q1X 2.5 ?
150 HHSearch 35.3137% -83 - C1 -3MQG 3.4 ?