Study : PA3823 (atomeDB@cbs.cnrs.fr)


Main Binding Site Prediction:


Binding Site Prediction

Download fasta file
Download text file


Binding Site Number :C4_S1
Best Complexes choosen after comparative docking [pKd > 3] : 5 (5 maxi)

Complexes [Theoretical pKd]FileVolume (A3)
(FPocket)
Hydrophobicity
Score(FPocket)
Contacts Ligand/Receptor [<4A] in Site C4_S1
Complex: GOL_A_5(2QII) / Model_49(2QII/A) = [3.5] Download387.6534.00MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA
Complex: PRF_A_3(1PXG) / Model_77(1PXG/A) = [3.8] Download480.4919.43MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA
Complex: GUN_A_2(4H7Z) / Model_81(4H7Z/A) = [3.8] Download454.5125.91MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA
Complex: GUN_A_3(2PWU) / Model_50(2PWU/A) = [3.9] Download404.0724.24MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA
Complex: QEI_A_10(4HSH) / Model_78(4HSH/A) = [4.0] Download566.8827.88MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA
Consensus
[pKd Mean = 3.80]
-458
(s=63)
26
(s=4)
MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA