@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3823: (2016-02-21 )
MNFELLATDGKARRGRLTFPRGVVETPAFMPVGTYGTVKGMLPRDIEDIGAQIILGNTFHLWLRPGTEVIQRHGDLHDFMQWKGPILTDSGGFQVFSLGAMRKIKEEGVTFASPVDGAKVFMGPEESMAVQRALGSDIVMIFDECTPYPADHDVAKRSMELSLRWAKRSKIAHGDSPSALFGIVQGGMHEDLRLRSLDGLQEIGFDGLAIGGLSVGEPKEEMIRVLDFLPPQMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHLFVDSGVIKIRNSVHKHDDSTLDPTCDCYTCKHFSRAYLHHLDKCGEMLGSMLNTIHNLRHYQRVMAGLREAIQQGTLAAFVDAFYAKRGLPTPPLDA

Atome Classification :

(50 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

CKR_A_6(4Q8P)
TGT_ZYMMO
[Raw transfer]




0EX_A_2(4GI4)
TGT_ZYMMO
[Raw transfer]




2MQ_A_3(3GC5)
TGT_ZYMMO
[Raw transfer]




AFQ_A_3(3GE7)
TGT_ZYMMO
[Raw transfer]




CKR_A_3(4Q8Q)
TGT_ZYMMO
[Raw transfer]




PK2_A_3(3EOS)
TGT_ZYMMO
[Raw transfer]




CKR_A_7(4Q8O)
TGT_ZYMMO
[Raw transfer]




0V2_A_3(4FR1)
TGT_ZYMMO
[Raw transfer]




2WU_A_5(4PUM)
TGT_ZYMMO
[Raw transfer]




0O1_A_4(4GKT)
TGT_ZYMMO
[Raw transfer]




CKR_A_8(4PUJ)
TGT_ZYMMO
[Raw transfer]




PK3_A_3(3EOU)
TGT_ZYMMO
[Raw transfer]




2WU_A_4(4PUL)
TGT_ZYMMO
[Raw transfer]




0V3_A_3(4FR6)
TGT_ZYMMO
[Raw transfer]




AAQ_A_2(3GC4)
TGT_ZYMMO
[Raw transfer]




0WY_A_3(4GIY)
TGT_ZYMMO
[Raw transfer]




PQ0_A_3(2QII)
TGT_ZYMMO
[Raw transfer]




0WX_A_3(4GH1)
TGT_ZYMMO
[Raw transfer]




AEK_A_3(3SM0)
TGT_ZYMMO
[Raw transfer]




AIQ_A_3(1K4G)
TGT_ZYMMO
[Raw transfer]




S60_A_3(3C2Y)
TGT_ZYMMO
[Raw transfer]




PRF_A_2(4E2V)
TGT_ZYMMO
[Raw transfer]




QEI_A_7(4HQV)
TGT_ZYMMO
[Raw transfer]




0EV_A_3(4GH3)
TGT_ZYMMO
[Raw transfer]




PRF_A_2(4GCX)
TGT_ZYMMO
[Raw transfer]




QEI_A_6(4HVX)
TGT_ZYMMO
[Raw transfer]




PRF_A_3(3BLD)
TGT_ZYMMO
[Raw transfer]




HRD_A_3(3RR4)
TGT_ZYMMO
[Raw transfer]




62D_A_6(3TLL)
TGT_ZYMMO
[Raw transfer]




PRF_A_3(2NQZ)
TGT_ZYMMO
[Raw transfer]




GOL_A_7(4IPP)
TGT_ZYMMO
[Raw transfer]




GUN_A_3(2PWU)
TGT_ZYMMO
[Raw transfer]




GUN_A_2(4H7Z)
TGT_ZYMMO
[Raw transfer]




GOL_A_8(2NQZ)
TGT_ZYMMO
[Raw transfer]




GOL_A_5(2QII)
TGT_ZYMMO
[Raw transfer]




GOL_A_9(4Q8M)
TGT_ZYMMO
[Raw transfer]




PRF_A_3(1PXG)
TGT_ZYMMO
[Raw transfer]




GOL_A_4(4L56)
TGT_ZYMMO
[Raw transfer]




GOL_A_9(4H6E)
TGT_ZYMMO
[Raw transfer]




GOL_A_7(4GD0)
TGT_ZYMMO
[Raw transfer]




QEI_A_10(4HSH)
TGT_ZYMMO
[Raw transfer]




59 PsiBlast_CBE 97.3354% -89 - C4 -4Q8V - TGT_ZYMMO -
72 PsiBlast_CBE 97.3053% -90 - C4 -4Q8M 2.7 TGT_ZYMMO
82 PsiBlast_CBE 97.2854% -88 - C4 -4GD0 2.7 TGT_ZYMMO
87 PsiBlast_CBE 97.1653% -87 - C4 -4IPP 2.5 TGT_ZYMMO
84 PsiBlast_CBE 97.1653% -88 - C4 -4Q8P 4.5 TGT_ZYMMO
60 PsiBlast_CBE 97.1154% -89 - C4 -4LEQ - TGT_ZYMMO -
81 PsiBlast_CBE 97.0454% -88 - C4 -4H7Z 3.8 TGT_ZYMMO
13 PsiBlast_PDB 96.9954% -86 - C4 -1P0B - TGT_ZYMMO -
58 PsiBlast_CBE 96.9154% -89 - C4 -4Q8W - TGT_ZYMMO -
11 PsiBlast_PDB 96.9154% -88 - C4 -1Q2R - TGT_ZYMMO -
83 PsiBlast_CBE 96.8854% -87 - C4 -4E2V 4.4 TGT_ZYMMO
31 PsiBlast_CBE 96.6354% -88 - C4 -4PUK - TGT_ZYMMO -
102 Fugue 96.5954% -88 - C4 -1K4G 5.4 TGT_ZYMMO
63 PsiBlast_CBE 96.5953% -87 - C4 -1EFZ - TGT_ZYMMO -
55 PsiBlast_CBE 96.5854% -89 - C4 -1Q2R - TGT_ZYMMO -
42 PsiBlast_CBE 96.5454% -90 - C4 -3RR4 5.7 TGT_ZYMMO
79 PsiBlast_CBE 96.5254% -87 - C4 -4DXX - TGT_ZYMMO -
28 PsiBlast_CBE 96.4854% -90 - C4 -4Q4O - TGT_ZYMMO -
20 PsiBlast_PDB 96.3954% -86 - C4 -1S39 - TGT_ZYMMO -
32 PsiBlast_CBE 96.3654% -90 - C4 -4PUJ 6.0 TGT_ZYMMO
94 PsiBlast_CBE 96.2753% -86 - C4 -4GCX 4.5 TGT_ZYMMO
49 PsiBlast_CBE 96.1754% -89 - C4 -2QII 4.8 TGT_ZYMMO
40 PsiBlast_CBE 96.1354% -90 - C4 -3TLL 5.9 TGT_ZYMMO
93 PsiBlast_CBE 95.8753% -87 - C4 -4H6E 2.7 TGT_ZYMMO
78 PsiBlast_CBE 95.7954% -86 - C4 -4HSH 4.0 TGT_ZYMMO
74 PsiBlast_CBE 95.6853% -87 - C4 -4PUM 5.7 TGT_ZYMMO
80 PsiBlast_CBE 95.5754% -88 - C4 -4HVX 4.3 TGT_ZYMMO
92 PsiBlast_CBE 95.4653% -86 - C4 -4HQV 4.3 TGT_ZYMMO
73 PsiBlast_CBE 95.2453% -90 - C4 -4PUL 5.5 TGT_ZYMMO
71 PsiBlast_CBE 95.2053% -89 - C4 -4Q8O 5.7 TGT_ZYMMO
44 PsiBlast_CBE 95.1854% -87 - C4 -3GC5 6.0 TGT_ZYMMO
91 PsiBlast_CBE 94.5654% -90 - C4 -2NQZ 4.4 TGT_ZYMMO
77 PsiBlast_CBE 94.5553% -93 - C4 -1PXG 3.8 TGT_ZYMMO
41 PsiBlast_CBE 94.4954% -88 - C4 -3SM0 7.6 TGT_ZYMMO
75 PsiBlast_CBE 94.4553% -93 - C4 -4Q8Q 5.5 TGT_ZYMMO
37 PsiBlast_CBE 94.4254% -91 - C4 -4GH1 7.5 TGT_ZYMMO
48 PsiBlast_CBE 94.4154% -84 - C4 -3C2Y 5.2 TGT_ZYMMO
43 PsiBlast_CBE 94.3354% -87 - C4 -3GE7 7.4 TGT_ZYMMO
33 PsiBlast_CBE 93.8554% -88 - C4 -4GKT 1.9 TGT_ZYMMO
35 PsiBlast_CBE 93.7954% -90 - C4 -4GI4 7.3 TGT_ZYMMO
47 PsiBlast_CBE 93.7354% -93 - C4 -3EOS 6.5 TGT_ZYMMO
88 PsiBlast_CBE 93.7153% -94 - C4 -4L56 2.3 TGT_ZYMMO
46 PsiBlast_CBE 92.9054% -92 - C4 -3EOU 5.8 TGT_ZYMMO
45 PsiBlast_CBE 92.5954% -83 - C4 -3GC4 1.1 TGT_ZYMMO
76 PsiBlast_CBE 92.3554% -91 - C4 -3BLD 4.3 TGT_ZYMMO
50 PsiBlast_CBE 92.3354% -86 - C4 -2PWU 3.9 TGT_ZYMMO
36 PsiBlast_CBE 92.1154% -86 - C4 -4GH3 6.3 TGT_ZYMMO
38 PsiBlast_CBE 90.9654% -90 - C4 -4FR6 7.2 TGT_ZYMMO
39 PsiBlast_CBE 90.6654% -91 - C4 -4FR1 5.6 TGT_ZYMMO
34 PsiBlast_CBE 90.0654% -87 - C4 -4GIY 7.4 TGT_ZYMMO