@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA3883: (2016-02-21 )
MSQPVAFVTGCSSGIGRALADAFQRAGYRVWASARKEDDVRALAEAGFQAVQLDVNDAAALARLAEELGVEAAGLDVLVNNAGYGAMGPLLDGGVEAMRRQFETNVFAVVGVTRALFPLLRRKSGLVVNVGSVSGVLVTPFAGAYCASKAAVHALSDALRLELAPFGVEVLEVQPGAIASNFGASASREMDSVVDERSPWWPLRRQIQARAAASQDNPTSAEDFARQLLAAVQRRPRPPLVRIGNGSRALPALARWLPRGLLERLLKKRFGLDTRL

Atome Classification :

(24 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAD_G_7(2D1Y)
?
[Raw transfer]



NAD_H_8(2D1Y)
?
[Raw transfer]



NAD_E_5(2D1Y)
?
[Raw transfer]



NAD_F_6(2D1Y)
?
[Raw transfer]
1 PsiBlast_PDB 85.3435% -94 - C1 -1IOL - DHB1_HUMAN -
18 PsiBlast_PDB 83.8434% -92 - C1 -3HB5 - DHB1_HUMAN -
7 PsiBlast_PDB 83.4734% -94 - C1 -1EQU - DHB1_HUMAN -
17 PsiBlast_PDB 83.3234% -95 - C1 -3HB4 - DHB1_HUMAN -
4 PsiBlast_PDB 83.3034% -92 - C1 -1FDT - DHB1_HUMAN -
24 PsiBlast_CBE 83.1534% -93 - C1 -1FDV - DHB1_HUMAN -
30 PsiBlast_CBE 82.9734% -98 - C1 -1FDU - DHB1_HUMAN -
26 PsiBlast_CBE 82.9634% -93 - C1 -1FDV - DHB1_HUMAN -
28 PsiBlast_CBE 82.8234% -93 - C1 -1FDU - DHB1_HUMAN -
3 PsiBlast_PDB 82.6334% -95 - C1 -1FDS - DHB1_HUMAN -
2 PsiBlast_PDB 82.4634% -92 - C1 -1A27 - DHB1_HUMAN -
22 PsiBlast_CBE 82.3534% -96 - C1 -1EQU - DHB1_HUMAN -
29 PsiBlast_CBE 82.1334% -95 - C1 -1FDU - DHB1_HUMAN -
10 PsiBlast_PDB 81.7234% -91 - C1 -1I5R - DHB1_HUMAN -
15 PsiBlast_PDB 81.6734% -92 - C1 -1BHS - DHB1_HUMAN -
21 PsiBlast_CBE 81.2134% -98 - C1 -3KM0 - DHB1_HUMAN -
8 PsiBlast_PDB 81.0234% -91 - C1 -1DHT - DHB1_HUMAN -
9 PsiBlast_PDB 80.7434% -94 - C1 -3DHE - DHB1_HUMAN -
12 PsiBlast_PDB 79.6734% -95 - C1 -1QYV - DHB1_HUMAN -
27 PsiBlast_CBE 79.0634% -95 - C1 -1FDU - DHB1_HUMAN -
56 PsiBlast_CBE 61.5035% -96 - C1 -2D1Y 6.1 ?
57 PsiBlast_CBE 61.3835% -98 - C1 -2D1Y 5.9 ?
59 PsiBlast_CBE 60.8035% -95 - C1 -2D1Y 5.3 ?
58 PsiBlast_CBE 59.2235% -95 - C1 -2D1Y 5.6 ?