@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4110: (2016-02-23 )
MRDTRFPCLCGIAASTLLFATTPAIAGEAPADRLKALVDAAVQPVMKANDIPGLAVAISLKGEPHYFSYGLASKEDGRRVTPETLFEIGSVSKTFTATLAGYALTQDKMRLDDRASQHWPALQGSRFDGISLLDLATYTAGGLPLQFPDSVQKDQAQIRDYYRQWQPTYAPGSQRLYSNPSIGLFGYLAARSLGQPFERLMEQQVFPALGLEQTHLDVPEAALAQYAQGYGKDDRPLRVGPGPLDAEGYGVKTSAADLLRFVDANLHPERLDRPWAQALDATHRGYYKVGDMTQGLGWEAYDWPISLKRLQAGNSTPMALQPHRIARLPAPQALEGQRLLNKTGSTNGFGAYVAFVPGRDLGLVILANRNYPNAERVKIAYAILSGLEQQGKVPLKR

Atome Classification :

(80 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

AZR_A_2(4WBG)
?
[Raw transfer]




MK7_A_2(4NK3)
AMPC_PSEAE
[Raw transfer]




OP0_A_3(4X68)
AMPC_PSEAE
[Raw transfer]




S1Y_A_2(3S1Y)
AMPC_PSEAE
[Raw transfer]




OP0_B_6(4X68)
AMPC_PSEAE
[Raw transfer]




3S2_A_2(3S22)
AMPC_PSEAE
[Raw transfer]




ZX0_A_2(2WZX)
AMPC_PSEAE
[Raw transfer]




NXL_A_4(4HEF)
AMPC_PSEAE
[Raw transfer]




1S6_B_3(4JXG)
AMPC_ECOLI
[Raw transfer]




1S6_A_5(4JXG)
AMPC_ECOLI
[Raw transfer]




AZR_A_3(1FR6)
?
[Raw transfer]




3VT_A_7(4WYY)
?
[Raw transfer]




ZX1_A_2(2WZZ)
AMPC_PSEAE
[Raw transfer]




3VU_A_3(4WZ4)
?
[Raw transfer]




NXL_A_2(4OOY)
AMPC_PSEAE
[Raw transfer]




AZR_B_4(1FR6)
?
[Raw transfer]




1MW_A_3(4JXW)
AMPC_ECOLI
[Raw transfer]




4D6_A_2(4XUX)
AMPC_ENTCL
[Raw transfer]




PCZ_B_6(4KG2)
AMPC_ECOLI
[Raw transfer]




18U_B_5(4JXS)
AMPC_ECOLI
[Raw transfer]




PCZ_A_8(4KG2)
AMPC_ECOLI
[Raw transfer]




1MU_A_3(4JXV)
AMPC_ECOLI
[Raw transfer]




0N3_B_7(4E3I)
AMPC_ECOLI
[Raw transfer]




1MW_B_5(4JXW)
AMPC_ECOLI
[Raw transfer]




NZ9_B_9(4KZA)
AMPC_ECOLI
[Raw transfer]




1MU_B_5(4JXV)
AMPC_ECOLI
[Raw transfer]




0NA_B_6(4E3K)
AMPC_ECOLI
[Raw transfer]




0NA_A_3(4E3K)
AMPC_ECOLI
[Raw transfer]




DVR_A_3(1GA0)
?
[Raw transfer]




NZ9_A_6(4KZA)
AMPC_ECOLI
[Raw transfer]




0NB_A_3(4E3L)
AMPC_ECOLI
[Raw transfer]




0NB_B_9(4E3L)
AMPC_ECOLI
[Raw transfer]




4A1_B_6(4KZ4)
AMPC_ECOLI
[Raw transfer]




0ND_B_5(4E3M)
AMPC_ECOLI
[Raw transfer]




0N4_B_5(4E3J)
AMPC_ECOLI
[Raw transfer]




0ND_A_3(4E3M)
AMPC_ECOLI
[Raw transfer]




0N4_A_3(4E3J)
AMPC_ECOLI
[Raw transfer]




1U5_A_3(4KZ7)
AMPC_ECOLI
[Raw transfer]




0NG_B_6(4E3O)
AMPC_ECOLI
[Raw transfer]




N95_B_5(4LV2)
AMPC_ECOLI
[Raw transfer]




CIT_A_4(4QD4)
?
[Raw transfer]




IPP_B_4(1BLS)
AMPC_ENTCL
[Raw transfer]




IPP_A_3(1BLS)
AMPC_ENTCL
[Raw transfer]




NL9_A_3(4LV1)
AMPC_ECOLI
[Raw transfer]




WY4_A_2(1ONH)
?
[Raw transfer]




0NG_A_3(4E3O)
AMPC_ECOLI
[Raw transfer]




0NE_A_3(4E3N)
AMPC_ECOLI
[Raw transfer]




ZB6_B_7(4KZ6)
AMPC_ECOLI
[Raw transfer]




N95_A_3(4LV2)
AMPC_ECOLI
[Raw transfer]




NL9_B_7(4LV1)
AMPC_ECOLI
[Raw transfer]




0NE_B_5(4E3N)
AMPC_ECOLI
[Raw transfer]




CIT_B_6(4QD4)
?
[Raw transfer]




2TV_A_3(4OLG)
AMPC_ECOLI
[Raw transfer]




2TV_B_5(4OLG)
AMPC_ECOLI
[Raw transfer]




FDT_A_2(1Y54)
AMPC_ENTCL
[Raw transfer]




IAP_A_2(1S6R)
?
[Raw transfer]




1U5_B_5(4KZ7)
AMPC_ECOLI
[Raw transfer]




APB_A_3(4LV0)
AMPC_ECOLI
[Raw transfer]




APB_B_5(4LV0)
AMPC_ECOLI
[Raw transfer]




LK7_A_2(2Q9M)
AMPC_ENTCL
[Raw transfer]




WY2_A_2(1Q2Q)
?
[Raw transfer]




25N_B_5(4LV3)
AMPC_ECOLI
[Raw transfer]




1U3_B_7(4KZ5)
AMPC_ECOLI
[Raw transfer]




2UZ_B_6(4OLD)
AMPC_ECOLI
[Raw transfer]




1U3_A_3(4KZ5)
AMPC_ECOLI
[Raw transfer]




2UZ_A_3(4OLD)
AMPC_ECOLI
[Raw transfer]




LK5_A_2(2Q9N)
AMPC_ENTCL
[Raw transfer]




1U6_A_3(4KZ8)
AMPC_ECOLI
[Raw transfer]




1U6_B_7(4KZ8)
AMPC_ECOLI
[Raw transfer]




NZ9_A_7(4KZA)
AMPC_ECOLI
[Raw transfer]




1U1_B_5(4KZ3)
AMPC_ECOLI
[Raw transfer]




1U1_A_3(4KZ3)
AMPC_ECOLI
[Raw transfer]




ACY_A_11(1ZKJ)
?
[Raw transfer]




NZ2_B_9(4KZB)
AMPC_ECOLI
[Raw transfer]




NZ2_A_6(4KZB)
AMPC_ECOLI
[Raw transfer]




7 PsiBlast_PDB 97.85100% -95 - C1 -4WYY 5.1 ?
6 PsiBlast_PDB 97.84100% -94 - C1 -4NK3 3.1 AMPC_PSEAE
1 PsiBlast_PDB 97.67100% -93 - C1 -2WZX 3.7 AMPC_PSEAE
8 PsiBlast_PDB 97.49100% -94 - C1 -4WZ4 5.2 ?
2 PsiBlast_PDB 97.32100% -94 - C1 -2WZZ 3.5 AMPC_PSEAE
3 PsiBlast_PDB 97.30100% -93 - C1 -4GZB - AMPC_PSEAE -
10 PsiBlast_PDB 96.8499% -93 - C1 -4HEF 3.1 AMPC_PSEAE
5 PsiBlast_PDB 96.68100% -93 - C1 -3S22 3.8 AMPC_PSEAE
9 PsiBlast_PDB 96.47100% -94 - C1 -4OOY 2.8 AMPC_PSEAE
4 PsiBlast_PDB 96.37100% -89 - C1 -3S1Y 5.3 AMPC_PSEAE
21 PsiBlast_CBE 96.33100% -94 - C1 -4X68 3.7 AMPC_PSEAE
11 PsiBlast_PDB 96.25100% -93 - C1 -4X68 4.0 AMPC_PSEAE
12 PsiBlast_PDB 82.8359% -97 - C1 -2QZ6 - AMPC_PSEFL -
110 HHSearch 82.7059% -98 - C1 -2QZ6 - AMPC_PSEFL -
15 PsiBlast_PDB 82.6956% -95 - C1 -3W8K - ? -
47 PsiBlast_CBE 82.3744% -86 - C1 -1FR6 4.3 ?
112 HHSearch 82.2756% -97 * C1 *3W8K - ? -
13 PsiBlast_PDB 81.9756% -93 - C1 -1ZKJ 2.6 ?
27 PsiBlast_CBE 81.9041% -95 - C1 -4U0T - ? -
18 PsiBlast_PDB 81.6742% -90 - C1 -4QD4 2.9 ?
14 PsiBlast_PDB 81.0656% -93 - C1 -4WBG 3.8 ?
32 PsiBlast_CBE 80.2942% -92 - C1 -4QD4 3.2 ?
34 PsiBlast_CBE 79.8945% -83 - C1 -1ONH 2.7 ?
79 PsiBlast_CBE 79.3743% -89 - C1 -4KG2 4.0 AMPC_ECOLI
44 PsiBlast_CBE 79.3545% -88 - C1 -1Y54 3.0 AMPC_ENTCL
83 PsiBlast_CBE 79.3243% -86 - C1 -4JXV 5.4 AMPC_ECOLI
41 PsiBlast_CBE 79.3045% -85 - C1 -2Q9N 2.2 AMPC_ENTCL
84 PsiBlast_CBE 79.2443% -88 - C1 -4JXS 4.6 AMPC_ECOLI
88 PsiBlast_CBE 79.2143% -88 - C1 -4E3O 3.8 AMPC_ECOLI
42 PsiBlast_CBE 79.2045% -83 - C1 -2Q9M 3.3 AMPC_ENTCL
35 PsiBlast_CBE 79.1245% -82 - C1 -1GA0 2.8 ?
49 PsiBlast_CBE 79.1043% -87 - C1 -4OLG 3.0 AMPC_ECOLI
80 PsiBlast_CBE 78.9543% -88 - C1 -4JXW 4.9 AMPC_ECOLI
86 PsiBlast_CBE 78.9143% -86 - C1 -4JXG 4.0 AMPC_ECOLI
54 PsiBlast_CBE 78.9143% -88 - C1 -4LV3 4.0 AMPC_ECOLI
55 PsiBlast_CBE 78.8243% -87 - C1 -4LV2 4.5 AMPC_ECOLI
50 PsiBlast_CBE 78.7743% -88 - C1 -4OLD 2.8 AMPC_ECOLI
89 PsiBlast_CBE 78.6443% -87 - C1 -4E3O 3.0 AMPC_ECOLI
78 PsiBlast_CBE 78.6443% -84 - C1 -4KG2 4.2 AMPC_ECOLI
38 PsiBlast_CBE 78.5745% -87 - C1 -1BLS 4.4 AMPC_ENTCL
81 PsiBlast_CBE 78.5643% -85 - C1 -4JXW 5.7 AMPC_ECOLI
70 PsiBlast_CBE 78.5043% -87 - C1 -4KZ6 3.8 AMPC_ECOLI
57 PsiBlast_CBE 78.4743% -86 - C1 -4LV1 5.2 AMPC_ECOLI
37 PsiBlast_CBE 78.3945% -85 - C1 -1Q2Q 4.6 ?
97 PsiBlast_CBE 78.3743% -87 - C1 -4E3K 4.9 AMPC_ECOLI
100 PsiBlast_CBE 78.3543% -88 - C1 -4E3I 5.4 AMPC_ECOLI
68 PsiBlast_CBE 78.3243% -87 - C1 -4KZ7 2.8 AMPC_ECOLI
67 PsiBlast_CBE 78.3243% -86 - C1 -4KZ8 2.9 AMPC_ECOLI
90 PsiBlast_CBE 78.3143% -87 - C1 -4E3N 5.0 AMPC_ECOLI
56 PsiBlast_CBE 78.3043% -87 - C1 -4LV2 4.7 AMPC_ECOLI
93 PsiBlast_CBE 78.2943% -86 - C1 -4E3M 5.2 AMPC_ECOLI
73 PsiBlast_CBE 78.2843% -87 - C1 -4KZ5 4.1 AMPC_ECOLI
60 PsiBlast_CBE 78.2743% -85 - C1 -4LV0 3.8 AMPC_ECOLI
58 PsiBlast_CBE 78.1843% -86 - C1 -4LV1 4.9 AMPC_ECOLI
92 PsiBlast_CBE 78.1743% -86 - C1 -4E3M 5.3 AMPC_ECOLI
99 PsiBlast_CBE 78.0343% -90 - C1 -4E3J 4.6 AMPC_ECOLI
95 PsiBlast_CBE 78.0343% -87 - C1 -4E3L 4.9 AMPC_ECOLI
43 PsiBlast_CBE 77.9945% -88 - C1 -1S6R 2.9 ?
96 PsiBlast_CBE 77.9543% -87 - C1 -4E3K 4.4 AMPC_ECOLI
62 PsiBlast_CBE 77.9543% -86 - C1 -4KZB 2.4 AMPC_ECOLI
82 PsiBlast_CBE 77.9043% -88 - C1 -4JXV 3.4 AMPC_ECOLI
94 PsiBlast_CBE 77.8943% -86 - C1 -4E3L 4.8 AMPC_ECOLI
87 PsiBlast_CBE 77.8543% -85 - C1 -4JXG 4.1 AMPC_ECOLI
51 PsiBlast_CBE 77.7843% -91 - C1 -4OLD 2.9 AMPC_ECOLI
74 PsiBlast_CBE 77.7343% -87 - C1 -4KZ4 3.8 AMPC_ECOLI
66 PsiBlast_CBE 77.7343% -84 - C1 -4KZ8 2.8 AMPC_ECOLI
59 PsiBlast_CBE 77.6943% -86 - C1 -4LV0 2.6 AMPC_ECOLI
72 PsiBlast_CBE 77.6843% -87 - C1 -4KZ5 4.3 AMPC_ECOLI
40 PsiBlast_CBE 77.6845% -84 - C1 -4XUX 4.5 AMPC_ENTCL
64 PsiBlast_CBE 77.6243% -85 - C1 -4KZA 2.8 AMPC_ECOLI
91 PsiBlast_CBE 77.4843% -85 - C1 -4E3N 5.1 AMPC_ECOLI
69 PsiBlast_CBE 77.4843% -85 - C1 -4KZ7 3.0 AMPC_ECOLI
77 PsiBlast_CBE 77.4543% -86 - C1 -4KZ3 3.2 AMPC_ECOLI
46 PsiBlast_CBE 77.4044% -83 - C1 -1FR6 3.6 ?
39 PsiBlast_CBE 77.4045% -87 - C1 -1BLS 4.2 AMPC_ENTCL
98 PsiBlast_CBE 77.2943% -87 - C1 -4E3J 4.4 AMPC_ECOLI
61 PsiBlast_CBE 77.2343% -86 - C1 -4KZB 2.6 AMPC_ECOLI
48 PsiBlast_CBE 77.2143% -87 - C1 -4OLG 3.8 AMPC_ECOLI
63 PsiBlast_CBE 76.9443% -85 - C1 -4KZA 3.0 AMPC_ECOLI
76 PsiBlast_CBE 76.7943% -87 - C1 -4KZ3 3.4 AMPC_ECOLI