@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4557: (2016-02-28 )
MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHEVVHNKFVVDNLRQRGAIFVEELDQVPNNVIVIFSAHGVSQAVRKEAEGRGLKVFDATCPLVTKVHMEVVRYSRDGHECVLIGHEGHPEVEGTMGQYDASNGGAIYLVEDEADVAALEVRKPEALHYVTQTTLSMDDTSKVIDALRAKFPQIQGPRKNDICYATQNRQDAVKELADQCDMVLVVGSPNSSNSNRLRELAERMGTPAYLIDGAEDMQRGWFDGVRRIGITAGASAPEVLVRGVIAQLREWGASEEQELEGREENITFSMPKELRVKAL

Atome Classification :

(60 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

0CH_A_4(3UV6)
ISPH_ECOLI
[Raw transfer]




2E4_A_4(4MUX)
?
[Raw transfer]




0CH_B_6(3UV6)
ISPH_ECOLI
[Raw transfer]




0CJ_B_6(3UTD)
ISPH_ECOLI
[Raw transfer]




0CJ_A_4(3UTD)
ISPH_ECOLI
[Raw transfer]




0JX_B_6(3UTC)
ISPH_ECOLI
[Raw transfer]




0K2_B_7(3UWM)
ISPH_ECOLI
[Raw transfer]




2E5_B_6(4MUY)
?
[Raw transfer]




H6P_B_6(3SZO)
ISPH_ECOLI
[Raw transfer]




H6P_B_6(3SZL)
ISPH_ECOLI
[Raw transfer]




10E_B_6(4H4D)
ISPH_ECOLI
[Raw transfer]




10G_B_6(4H4E)
ISPH_ECOLI
[Raw transfer]




0CN_B_6(3UV7)
ISPH_ECOLI
[Raw transfer]




2E7_A_4(4MV5)
?
[Raw transfer]




10E_B_6(3ZGL)
ISPH_ECOLI
[Raw transfer]




10G_A_4(4H4E)
ISPH_ECOLI
[Raw transfer]




2E7_B_6(4MV5)
?
[Raw transfer]




SF4_A_3(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4MUX)
?
[Raw transfer]




SF4_A_3(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV3)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UV6)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4MUX)
?
[Raw transfer]




SF4_B_5(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4E)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UV7)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE8)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(4H4D)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3KE9)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4EB3)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(4H4C)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3UTC)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3URK)
ISPH_ECOLI
[Raw transfer]




SF4_B_6(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3UWM)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZO)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_B_5(3ZGN)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3SZL)
ISPH_ECOLI
[Raw transfer]




SF4_A_3(3ZGL)
ISPH_ECOLI
[Raw transfer]




SF4_A_4(3ZGN)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MV0)
?
[Raw transfer]




F3S_B_5(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(4MUY)
?
[Raw transfer]




F3S_A_3(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3T0F)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3SZU)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MUY)
?
[Raw transfer]




F3S_A_3(3UTD)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(4MV0)
?
[Raw transfer]




F3S_A_3(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEL)
ISPH_ECOLI
[Raw transfer]




F3S_B_9(3F7T)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3T0G)
ISPH_ECOLI
[Raw transfer]




F3S_B_6(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_B_5(3KEF)
ISPH_ECOLI
[Raw transfer]




F3S_A_4(3KEM)
ISPH_ECOLI
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_B_4(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




F3S_A_3(3DNF)
ISPH_AQUAE
[Raw transfer]




49 PsiBlast_CBE 99.0567%-104 - C9 -3UTC 5.0 ISPH_ECOLI
39 PsiBlast_CBE 98.8867%-101 - C9 -3UWM 4.6 ISPH_ECOLI
30 PsiBlast_CBE 98.8467%-102 - C9 -3ZGL 5.7 ISPH_ECOLI
41 PsiBlast_CBE 98.7467%-102 - C9 -3UV7 5.3 ISPH_ECOLI
28 PsiBlast_CBE 98.7267%-102 - C9 -3F7T 3.3 ISPH_ECOLI
47 PsiBlast_CBE 98.7167%-103 - C9 -3UTD 5.8 ISPH_ECOLI
14 PsiBlast_PDB 98.7067%-104 - C9 -4MUX 5.6 ?
6 PsiBlast_PDB 98.6867%-100 - C9 -3F7T 3.4 ISPH_ECOLI
26 PsiBlast_CBE 98.6467%-102 - C9 -3SZO 5.8 ISPH_ECOLI
31 PsiBlast_CBE 98.4467%-105 - C9 -4MV5 6.2 ?
20 PsiBlast_PDB 98.4367%-102 - C9 -3UTC 3.8 ISPH_ECOLI
33 PsiBlast_CBE 98.3667%-104 - C9 -4MUY 5.7 ?
43 PsiBlast_CBE 98.3567%-103 - C9 -3UV6 5.6 ISPH_ECOLI
37 PsiBlast_CBE 98.2667%-103 - C9 -4H4D 6.0 ISPH_ECOLI
44 PsiBlast_CBE 98.2467%-102 - C9 -3UV6 5.8 ISPH_ECOLI
36 PsiBlast_CBE 98.2467%-101 - C9 -4H4E 5.5 ISPH_ECOLI
18 PsiBlast_PDB 98.2167%-104 - C9 -4H4E 5.5 ISPH_ECOLI
48 PsiBlast_CBE 98.2067% -99 - C9 -3UTD 5.9 ISPH_ECOLI
27 PsiBlast_CBE 98.1867%-104 - C9 -3SZL 5.8 ISPH_ECOLI
9 PsiBlast_PDB 98.1367%-100 - C9 -3ZGL 3.8 ISPH_ECOLI
45 PsiBlast_CBE 98.1267%-101 - C9 -3UV3 3.9 ISPH_ECOLI
29 PsiBlast_CBE 98.0967%-102 - C9 -3ZGN 3.7 ISPH_ECOLI
35 PsiBlast_CBE 98.0867%-105 - C9 -4EB3 3.9 ISPH_ECOLI
17 PsiBlast_PDB 98.0667%-101 - C9 -4H4D 3.8 ISPH_ECOLI
24 PsiBlast_CBE 98.0367%-100 - C9 -3KE9 3.8 ISPH_ECOLI
15 PsiBlast_PDB 98.0367%-106 - C9 -4MV5 6.2 ?
16 PsiBlast_PDB 98.0267%-102 - C9 -4H4C 3.7 ISPH_ECOLI
42 PsiBlast_CBE 97.9767%-101 - C9 -3UV7 3.9 ISPH_ECOLI
40 PsiBlast_CBE 97.9767%-102 - C9 -3UWM 3.8 ISPH_ECOLI
54 PsiBlast_CBE 97.9666%-103 - C9 -3T0F 3.8 ISPH_ECOLI
46 PsiBlast_CBE 97.9467%-101 - C9 -3UV3 3.8 ISPH_ECOLI
12 PsiBlast_PDB 97.9367%-103 - C9 -4MUY 3.8 ?
4 PsiBlast_PDB 97.8867%-103 - C9 -3KEL 3.6 ISPH_ECOLI
32 PsiBlast_CBE 97.8667%-104 - C9 -4MV0 3.8 ?
3 PsiBlast_PDB 97.8667%-104 - C9 -3KEF 3.5 ISPH_ECOLI
34 PsiBlast_CBE 97.8467%-105 - C9 -4MUX 3.8 ?
10 PsiBlast_PDB 97.8467%-101 - C9 -3ZGN 3.7 ISPH_ECOLI
11 PsiBlast_PDB 97.8067%-102 - C9 -4EB3 3.9 ISPH_ECOLI
1 PsiBlast_PDB 97.7767% -98 - C9 -3KE8 3.8 ISPH_ECOLI
13 PsiBlast_PDB 97.7567%-105 - C9 -4MV0 3.8 ?
25 PsiBlast_CBE 97.6667%-102 - C9 -3KE8 3.8 ISPH_ECOLI
19 PsiBlast_PDB 97.6667%-103 - C9 -3URK 3.9 ISPH_ECOLI
7 PsiBlast_PDB 97.5967%-101 - C9 -3SZL 3.8 ISPH_ECOLI
56 PsiBlast_CBE 97.5066%-103 - C9 -3T0G 3.8 ISPH_ECOLI
21 PsiBlast_CBE 97.4767%-101 - C9 -3KEM 3.5 ISPH_ECOLI
38 PsiBlast_CBE 97.4367%-101 - C9 -4H4C 3.9 ISPH_ECOLI
23 PsiBlast_CBE 97.4267%-103 - C9 -3KEF 3.5 ISPH_ECOLI
51 PsiBlast_CBE 97.4066%-101 - C9 -3SZU 3.8 ISPH_ECOLI
5 PsiBlast_PDB 97.3767%-101 - C9 -3KEM 3.6 ISPH_ECOLI
2 PsiBlast_PDB 97.3767%-102 - C9 -3KE9 3.8 ISPH_ECOLI
50 PsiBlast_CBE 97.3267%-101 - C9 -3URK 3.9 ISPH_ECOLI
22 PsiBlast_CBE 97.2067%-104 - C9 -3KEL 3.6 ISPH_ECOLI
8 PsiBlast_PDB 96.9867% -99 - C9 -3SZO 3.8 ISPH_ECOLI
55 PsiBlast_CBE 96.7766%-103 * C9 *3T0G 3.8 ISPH_ECOLI
52 PsiBlast_CBE 96.3166%-103 - C9 -3SZU 3.8 ISPH_ECOLI
53 PsiBlast_CBE 92.8066%-115 - C9 -3T0F 3.8 ISPH_ECOLI
57 PsiBlast_CBE 76.3234%-107 - C9 -3DNF 3.7 ISPH_AQUAE
59 Fugue 75.6934%-107 - C9 -3DNF 3.7 ISPH_AQUAE
58 PsiBlast_CBE 75.3634%-105 - C9 -3DNF 3.7 ISPH_AQUAE
69 HHSearch 74.7434%-100 - C9 -3DNF 3.7 ISPH_AQUAE