@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4728: (2016-02-29 )
MIQRVYVALGSNLAEPREQIQAALDAFERLPETRLVAVSPLYISDPLGPADQPRFVNGVAALDTNLAPLDLLDALQAIELEQGRVRDLRWGPRTLDLDILLFGEQLLDLPRLKVPHYHMQARAFVLYPLADLAPDLRLPDGRHLPELLAACPFEGIERLPGA

Atome Classification :

(61 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

APC_A_4(4CWB)
?
[Raw transfer]




APC_A_7(4CYU)
?
[Raw transfer]




APC_A_15(1TMM)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5G)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HD1)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HSG)
HPPK_ECOLI
[Raw transfer]




APC_A_2(3KUH)
HPPK_ECOLI
[Raw transfer]




APC_A_5(4M5N)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HT0)
HPPK_ECOLI
[Raw transfer]




APC_A_4(3HD2)
HPPK_ECOLI
[Raw transfer]




APC_A_5(4M5I)
HPPK_ECOLI
[Raw transfer]




APC_B_17(1TMM)
HPPK_ECOLI
[Raw transfer]




APC_A_9(1Q0N)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5J)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5K)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4M5H)
HPPK_ECOLI
[Raw transfer]




APC_B_9(4M5N)
HPPK_ECOLI
[Raw transfer]




APC_A_9(1HQ2)
HPPK_ECOLI
[Raw transfer]




APC_C_15(4CYU)
?
[Raw transfer]




APC_A_2(4M5L)
HPPK_ECOLI
[Raw transfer]




APC_A_2(4CRJ)
?
[Raw transfer]




APC_A_5(1F9H)
HPPK_ECOLI
[Raw transfer]




ATP_A_2(1DY3)
HPPK_ECOLI
[Raw transfer]




APC_A_3(3ILO)
HPPK_ECOLI
[Raw transfer]




APC_A_3(4M5M)
HPPK_ECOLI
[Raw transfer]




APC_A_5(1RU2)
HPPK_ECOLI
[Raw transfer]




APC_B_10(3MCO)
?
[Raw transfer]




APC_A_8(1RU1)
HPPK_ECOLI
[Raw transfer]




APC_B_10(1RU1)
HPPK_ECOLI
[Raw transfer]




APC_D_18(4CYU)
?
[Raw transfer]




ADP_A_4(1EQM)
HPPK_ECOLI
[Raw transfer]




APC_B_11(4CYU)
?
[Raw transfer]




APC_A_3(3ILJ)
HPPK_ECOLI
[Raw transfer]




APC_A_5(3MCO)
?
[Raw transfer]




AMP_A_2(1RAO)
HPPK_ECOLI
[Raw transfer]




J1B_A_2(3UDE)
HPPK_ECOLI
[Raw transfer]




A4P_A_4(1EX8)
HPPK_ECOLI
[Raw transfer]




PMM_A_3(2BMB)

[Raw transfer]




PMM_A_3(2BMB)

[Raw transfer]




HH2_A_2(1RB0)
HPPK_ECOLI
[Raw transfer]




GOL_B_15(3HSD)
HPPK_ECOLI
[Raw transfer]




J1A_A_2(3UD5)
HPPK_ECOLI
[Raw transfer]




GOL_A_9(3HSD)
HPPK_ECOLI
[Raw transfer]




J1C_A_2(3UDV)
HPPK_ECOLI
[Raw transfer]




GOL_A_10(3HSD)
HPPK_ECOLI
[Raw transfer]




GOL_A_9(1RTZ)
HPPK_ECOLI
[Raw transfer]




B57_B_5(3MCN)
?
[Raw transfer]




J1D_A_2(4F7V)
HPPK_ECOLI
[Raw transfer]




GOL_A_5(3HSJ)
HPPK_ECOLI
[Raw transfer]




GSY_B_4(4AD6)
?
[Raw transfer]




ROI_E_5(1CBK)
HPPK_HAEIN
[Raw transfer]




EDO_A_4(3UD5)
HPPK_ECOLI
[Raw transfer]




ROI_E_5(1CBK)
HPPK_HAEIN
[Raw transfer]




ROI_E_5(1CBK)
HPPK_HAEIN
[Raw transfer]




ROI_F_6(1CBK)
HPPK_HAEIN
[Raw transfer]




TRS_A_4(3HSZ)
HPPK_ECOLI
[Raw transfer]




TRS_A_3(3HSZ)
HPPK_ECOLI
[Raw transfer]




HH2_A_3(1RAO)
HPPK_ECOLI
[Raw transfer]




EDO_A_3(3UD5)
HPPK_ECOLI
[Raw transfer]




TRS_A_3(3HCX)
HPPK_ECOLI
[Raw transfer]




B55_B_4(3QBC)
?
[Raw transfer]




GSY_B_4(4AD6)
?
[Raw transfer]




GSY_A_3(4AD6)
?
[Raw transfer]




APC_B_8(2QX0)
?
[Raw transfer]




B55_B_4(3QBC)
?
[Raw transfer]




APC_B_8(2QX0)
?
[Raw transfer]




B55_A_3(3QBC)
?
[Raw transfer]




84 HHSearch 96.5959%-128 - C7 -2QX0 2.9 ?
1 PsiBlast_PDB 94.9759%-132 - C7 -2QX0 2.9 ?
83 HHSearch 93.4051%-129 - C7 -1CBK 3.4 HPPK_HAEIN
9 PsiBlast_PDB 93.0951%-129 - C7 -4M5N 6.8 HPPK_ECOLI
43 PsiBlast_CBE 92.8350%-138 - C7 -3HD1 5.6 HPPK_ECOLI
24 PsiBlast_CBE 92.7751%-137 - C7 -3UDE 8.6 HPPK_ECOLI
73 Fugue 92.7650%-131 - C7 -1CBK 3.4 HPPK_HAEIN
7 PsiBlast_PDB 92.3651%-129 - C7 -4M5L 7.3 HPPK_ECOLI
30 PsiBlast_CBE 92.1951%-136 - C7 -3HSD 2.0 HPPK_ECOLI
2 PsiBlast_PDB 92.1651%-128 - C7 -4M5G 7.0 HPPK_ECOLI
45 PsiBlast_CBE 92.1150%-139 - C7 -3HT0 5.6 HPPK_ECOLI
8 PsiBlast_PDB 92.0951%-130 - C7 -4M5M 7.6 HPPK_ECOLI
19 PsiBlast_PDB 92.0351%-133 - C7 -1HKA - HPPK_ECOLI -
11 PsiBlast_PDB 91.9651%-127 - C7 -1EX8 9.8 HPPK_ECOLI
47 PsiBlast_CBE 91.9250%-127 - C7 -3KUH 6.4 HPPK_ECOLI
4 PsiBlast_PDB 91.9151%-127 - C7 -4M5I 7.2 HPPK_ECOLI
37 PsiBlast_CBE 91.8650%-127 - C7 -1F9H 7.6 HPPK_ECOLI
21 PsiBlast_CBE 91.8651%-131 - C7 -4M5N 6.8 HPPK_ECOLI
29 PsiBlast_CBE 91.7351%-135 - C7 -3HSD 3.6 HPPK_ECOLI
15 PsiBlast_PDB 91.7151%-137 - C7 -1RAO 4.6 HPPK_ECOLI
12 PsiBlast_PDB 91.6751%-133 - C7 -1EQM 3.5 HPPK_ECOLI
16 PsiBlast_PDB 91.6551%-127 - C7 -1RB0 5.0 HPPK_ECOLI
31 PsiBlast_CBE 91.6350%-137 - C7 -3HD2 5.5 HPPK_ECOLI
28 PsiBlast_CBE 91.5751%-132 - C7 -3HSG 6.6 HPPK_ECOLI
6 PsiBlast_PDB 91.5651%-129 - C7 -4M5K 7.4 HPPK_ECOLI
3 PsiBlast_PDB 91.5251%-126 - C7 -4M5H 7.3 HPPK_ECOLI
10 PsiBlast_PDB 91.3651%-129 - C7 -1DY3 7.0 HPPK_ECOLI
23 PsiBlast_CBE 91.2951%-138 - C7 -3UDV 7.8 HPPK_ECOLI
14 PsiBlast_PDB 91.2451%-127 - C7 -1Q0N 6.9 HPPK_ECOLI
20 PsiBlast_PDB 91.2251%-141 - C7 -3UD5 6.8 HPPK_ECOLI
38 PsiBlast_CBE 91.2050%-129 - C7 -3ILO 7.2 HPPK_ECOLI
42 PsiBlast_CBE 90.9950%-135 - C7 -3HSJ 1.9 HPPK_ECOLI
5 PsiBlast_PDB 90.8151%-133 - C7 -4M5J 6.5 HPPK_ECOLI
46 PsiBlast_CBE 90.7650%-130 - C7 -3HSZ 3.4 HPPK_ECOLI
44 PsiBlast_CBE 90.6750%-135 - C7 -3HCX 2.8 HPPK_ECOLI
40 PsiBlast_CBE 90.3550%-127 - C7 -3ILJ 4.7 HPPK_ECOLI
22 PsiBlast_CBE 90.0451%-126 - C7 -4F7V 9.5 HPPK_ECOLI
54 PsiBlast_CBE 89.8149%-143 - C7 -1RTZ 2.6 HPPK_ECOLI
49 PsiBlast_CBE 89.6150%-122 - C7 -1TMM 5.1 HPPK_ECOLI
48 PsiBlast_CBE 89.5350%-122 - C7 -1TMM 4.9 HPPK_ECOLI
34 PsiBlast_CBE 89.4850%-124 - C7 -1HQ2 6.5 HPPK_ECOLI
52 PsiBlast_CBE 88.3149%-134 - C7 -1RU1 4.8 HPPK_ECOLI
51 PsiBlast_CBE 88.0849%-145 - C7 -1RU2 5.0 HPPK_ECOLI
25 PsiBlast_CBE 86.2055%-128 - C7 -1CBK 3.4 HPPK_HAEIN
26 PsiBlast_CBE 85.8055%-128 - C7 -1CBK 3.4 HPPK_HAEIN
53 PsiBlast_CBE 85.6649%-144 - C7 -1RU1 4.7 HPPK_ECOLI
64 PsiBlast_CBE 78.1241%-124 - C7 -3QBC 3.1 ?
63 PsiBlast_CBE 77.9041%-125 - C7 -3QBC 3.3 ?
87 HHSearch 77.8035%-132 * C7 *2BMB 4.8
61 PsiBlast_CBE 77.7441%-124 - C7 -4AD6 3.8 ?
62 PsiBlast_CBE 77.6641%-126 - C7 -4AD6 2.7 ?
60 PsiBlast_CBE 77.6041%-121 - C7 -4CRJ 7.2 ?
56 PsiBlast_CBE 77.3241%-120 - C7 -4CYU 4.4 ?
59 PsiBlast_CBE 76.9941%-119 - C7 -4CWB 7.4 ?
58 PsiBlast_CBE 76.4941%-122 - C7 -4CYU 4.8 ?
55 PsiBlast_CBE 76.4441%-124 - C7 -4CYU 6.1 ?
57 PsiBlast_CBE 76.3641%-118 - C7 -4CYU 5.5 ?
65 PsiBlast_CBE 75.2537%-131 - C7 -2BMB 4.8
68 PsiBlast_CBE 73.1333%-117 - C7 -3MCO 6.1 ?
67 PsiBlast_CBE 70.2533%-127 - C7 -3MCO 5.5 ?
69 PsiBlast_CBE 69.9833%-120 - C7 -3MCN 4.7 ?