@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4748: (2016-03-01 )
MRRPLVAGNWKMHGTHSSVAELIKGLRQLALPSGVDVAVMPPCLFISQVIQGLAGKAIDVGAQNSAVEPMQGALTGETAPSQLADVGCSMVLVGHSERRLILGESDEVVSRKFAAAQSCGLVPVLCVGETRAEREAGKTLEVVARQLGSVIDELGVGAFARAVVAYEPVWAIGTGLTASPAQAQEVHAAIRAQLAAENAEVAKGVRLLYGGSVKAASAAELFGMPDIDGGLVGGASLNADEFGAICRAAGS

Atome Classification :

(67 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

PGH_B_4(1TPW)
TPIS_CHICK
[Raw transfer]




G3P_B_5(3UWU)
TPIS_STAAR
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




PGH_A_2(2VXN)
TPIS_LEIME
[Raw transfer]




PGA_D_4(1SW3)
TPIS_CHICK
[Raw transfer]




PGH_A_3(1TPW)
TPIS_CHICK
[Raw transfer]




PGA_D_4(1SW0)
TPIS_CHICK
[Raw transfer]




PGA_C_3(1SW0)
TPIS_CHICK
[Raw transfer]




PGA_C_3(1SW3)
TPIS_CHICK
[Raw transfer]




PGA_B_4(1SW7)
TPIS_CHICK
[Raw transfer]




PGA_A_3(1SW7)
TPIS_CHICK
[Raw transfer]




PGA_A_3(2J27)
TPIS_TRYBB
[Raw transfer]




PGH_B_4(7TIM)
TPIS_YEAST
[Raw transfer]




PGH_A_3(1TPU)
TPIS_CHICK
[Raw transfer]




PGA_B_4(2YPI)
TPIS_YEAST
[Raw transfer]




PGA_C_3(1QDS)
TPIS_LEIME
[Raw transfer]




PGA_B_4(1SSG)
TPIS_CHICK
[Raw transfer]




PGA_C_3(2BTM)
TPIS_GEOSE
[Raw transfer]




PGA_A_2(1N55)
TPIS_LEIME
[Raw transfer]




PEP_B_4(4OWG)
TPIS_RABIT
[Raw transfer]




PGH_B_4(1TPU)
TPIS_CHICK
[Raw transfer]




PGH_A_3(7TIM)
TPIS_YEAST
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




129_C_3(1IF2)
TPIS_LEIME
[Raw transfer]




PGA_A_3(4FF7)
TPIS_YEAST
[Raw transfer]




PGA_B_3(1HTI)
TPIS_HUMAN
[Raw transfer]




PGA_A_3(2YPI)
TPIS_YEAST
[Raw transfer]




G2H_A_3(3UWZ)
TPIS_STAAR
[Raw transfer]




PGA_A_3(1SSG)
TPIS_CHICK
[Raw transfer]




PEP_A_3(4OWG)
TPIS_RABIT
[Raw transfer]




PGH_A_3(3YPI)
TPIS_YEAST
[Raw transfer]




3PG_B_6(3UWW)
TPIS_STAAR
[Raw transfer]




1GP_A_2(2Y61)
TPIS_LEIME
[Raw transfer]




BBR_A_2(2Y63)
TPIS_LEIME
[Raw transfer]




G3P_A_2(2Y62)
TPIS_LEIME
[Raw transfer]




GOL_B_13(4FF7)
TPIS_YEAST
[Raw transfer]




GOL_A_3(4HHP)
?
[Raw transfer]




PGH_B_4(3YPI)
TPIS_YEAST
[Raw transfer]




3PG_A_4(3UWW)
TPIS_STAAR
[Raw transfer]




G2H_B_5(3UWZ)
TPIS_STAAR
[Raw transfer]




UVW_A_4(4MVA)
?
[Raw transfer]




2PG_A_5(3UWV)
TPIS_STAAR
[Raw transfer]




2PG_B_7(3UWV)
TPIS_STAAR
[Raw transfer]




3PY_A_4(1O5X)
TPIS_PLAFA
[Raw transfer]




CIT_B_5(3M9Y)
TPIS_STAAR
[Raw transfer]




PEG_B_9(4MVA)
?
[Raw transfer]




MRD_A_2(4MKN)
?
[Raw transfer]




CIT_A_4(3UWU)
TPIS_STAAR
[Raw transfer]




EDO_A_5(3KXQ)
TPIS_BARHE
[Raw transfer]




21 PsiBlast_CBE 94.3952%-113 - C5 -4MVA 2.0 ?
1 PsiBlast_PDB 93.9652%-110 - C5 -4K6A - ? -
4 PsiBlast_PDB 93.3852%-108 - C5 -4IOT - TPIS_ECODH -
2 PsiBlast_PDB 93.2452%-109 - C5 -4MVA 3.7 ?
8 PsiBlast_PDB 90.9249%-101 - C5 -4OHQ - TPIC_ARATH -
3 PsiBlast_PDB 90.4952%-105 - C5 -1TRE - TPIS_ECOLI -
101 Fugue 89.9652%-102 - C5 -1TRE - TPIS_ECOLI -
24 PsiBlast_CBE 88.8151%-105 - C5 -1TMH - TPIS_ECOLI -
17 PsiBlast_PDB 88.7045%-107 - C5 -1R2T - TPIS_RABIT -
22 PsiBlast_CBE 88.6551%-103 - C5 -1TMH - TPIS_ECOLI -
23 PsiBlast_CBE 88.6251%-105 - C5 -1TMH - TPIS_ECOLI -
44 PsiBlast_CBE 88.4845%-109 - C5 -1R2R - TPIS_RABIT -
14 PsiBlast_PDB 88.3844%-104 - C5 -4Y8F - ? -
113 HHSearch 88.3350%-102 - C5 -1AW2 - TPIS_MORMI -
37 PsiBlast_CBE 88.3350%-101 - C5 -4G1K - ? -
35 PsiBlast_CBE 88.1150%-105 - C5 -4G1K - ? -
36 PsiBlast_CBE 87.9250%-101 - C5 -4G1K - ? -
5 PsiBlast_PDB 87.9051%-106 - C5 -1TMH - TPIS_ECOLI -
45 PsiBlast_CBE 87.6845%-106 - C5 -1R2R - TPIS_RABIT -
9 PsiBlast_PDB 87.5750%-102 - C5 -4G1K - ? -
84 PsiBlast_CBE 87.0742%-108 - C5 -2Y62 3.7 TPIS_LEIME
68 PsiBlast_CBE 86.6944%-106 - C5 -4HHP 3.2 ?
10 PsiBlast_PDB 86.5345%-101 - C5 -4MKN 2.8 ?
83 PsiBlast_CBE 86.4642%-106 - C5 -2Y63 3.1 TPIS_LEIME
102 Fugue 86.3041%-103 - C5 -1IF2 4.3 TPIS_LEIME
88 PsiBlast_CBE 86.2242%-107 - C5 -1N55 3.4 TPIS_LEIME
85 PsiBlast_CBE 85.9042%-106 - C5 -2Y61 3.8 TPIS_LEIME
18 PsiBlast_PDB 85.5445%-103 - C5 -4OWG 3.2 TPIS_RABIT
86 PsiBlast_CBE 85.4742%-105 - C5 -2VXN 4.4 TPIS_LEIME
80 PsiBlast_CBE 85.4143%-104 - C5 -1SW7 3.2 TPIS_CHICK
87 PsiBlast_CBE 85.3742%-104 - C5 -1QDS 4.1 TPIS_LEIME
116 HHSearch 85.3039%-106 - C5 -2J27 2.8 TPIS_TRYBB
120 HHSearch 85.0842%-102 - C5 -2VXN 4.4 TPIS_LEIME
95 PsiBlast_CBE 84.6140%-104 - C5 -3UWW 3.8 TPIS_STAAR
79 PsiBlast_CBE 84.5743%-101 - C5 -1SW7 4.1 TPIS_CHICK
64 PsiBlast_CBE 84.4244%-102 - C5 -1SW0 3.1 TPIS_CHICK
89 PsiBlast_CBE 84.4042%-102 - C5 -1IF2 4.3 TPIS_LEIME
72 PsiBlast_CBE 84.3244%-103 - C5 -1SW3 3.3 TPIS_CHICK
99 PsiBlast_CBE 84.2540%-102 - C5 -3UWU 2.9 TPIS_STAAR
74 PsiBlast_CBE 84.0844%-104 - C5 -1TPW 4.6 TPIS_CHICK
97 PsiBlast_CBE 84.0140%-101 - C5 -3UWV 2.7 TPIS_STAAR
94 PsiBlast_CBE 83.8840%-101 - C5 -3UWW 3.3 TPIS_STAAR
121 HHSearch 83.7639%-104 - C5 -1O5X 3.2 TPIS_PLAFA
43 PsiBlast_CBE 83.6545%-102 - C5 -4OWG 3.2 TPIS_RABIT
71 PsiBlast_CBE 83.6044%-103 - C5 -1SW3 3.9 TPIS_CHICK
76 PsiBlast_CBE 83.5443%-102 - C5 -1SSG 3.1 TPIS_CHICK
98 PsiBlast_CBE 83.4340%-101 - C5 -3UWU 4.1 TPIS_STAAR
63 PsiBlast_CBE 83.3544%-101 - C5 -1SW0 3.2 TPIS_CHICK
49 PsiBlast_CBE 83.0545%-102 - C5 -1HTI 3.6 TPIS_HUMAN
93 PsiBlast_CBE 82.9940%-101 - C5 -3UWZ 2.2 TPIS_STAAR
111 HHSearch 82.9740%-101 - C5 -2BTM 4.0 TPIS_GEOSE
96 PsiBlast_CBE 82.7540%-101 - C5 -3UWV 3.2 TPIS_STAAR
90 PsiBlast_CBE 82.6040%-101 - C5 -3M9Y 2.0 TPIS_STAAR
81 PsiBlast_CBE 82.2444% -98 - C5 -1TPU 3.5 TPIS_CHICK
92 PsiBlast_CBE 82.1640%-104 - C5 -3UWZ 2.1 TPIS_STAAR
73 PsiBlast_CBE 82.0744%-100 - C5 -1TPW 3.9 TPIS_CHICK
75 PsiBlast_CBE 81.8243%-100 - C5 -1SSG 3.7 TPIS_CHICK
82 PsiBlast_CBE 81.4844% -99 - C5 -1TPU 3.7 TPIS_CHICK
60 PsiBlast_CBE 81.0342%-108 - C5 -3YPI 3.9 TPIS_YEAST
54 PsiBlast_CBE 80.1543%-108 - C5 -2YPI 3.7 TPIS_YEAST
61 PsiBlast_CBE 79.6842%-108 - C5 -4FF7 2.3 TPIS_YEAST
62 PsiBlast_CBE 78.4042%-104 - C5 -4FF7 3.3 TPIS_YEAST
125 HHSearch 78.0440% -95 - C5 -3KXQ 3.3 TPIS_BARHE
52 PsiBlast_CBE 77.2243%-102 - C5 -7TIM 3.9 TPIS_YEAST
59 PsiBlast_CBE 77.0042%-105 - C5 -3YPI 3.4 TPIS_YEAST
51 PsiBlast_CBE 76.1443%-101 - C5 -7TIM 3.6 TPIS_YEAST
53 PsiBlast_CBE 70.9043% -94 - C5 -2YPI 3.8 TPIS_YEAST