@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA4806: (2016-03-01 )
MISLERKGHAPTLLYERGIAERFREAIIRRYFSRGYLLDPFCLAVEEGLPEGFYTLGEIAPDDFFQSAYYQTYYLGAGAVEDVYYILDLGPTEKLSICLYNGLSASRYSDAQVAALAGLAPPVLELARQFCAGRADLSPNPQADLAPRLQEVLRGFGRGVLTDREREACHLLLSGHSAKSSARLMDISPETVRMHRKNLYTKLEVGSQSELFALFIECLSQGQRVGP

Atome Classification :

(20 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NACID_D_2(1JE8)
NARL_ECOLI
[Raw transfer]

-

63 Fugue 66.1322% -81 - C2 -1ZEL - ? -
62 Fugue 64.2733%-100 - C5 -1FSE - GERE_BACSU -
40 HHSearch 62.4216% -88 * C6 *3QP6 - ? -
42 HHSearch 58.2214% -76 - C5 -3SZT - ? -
64 Fugue 58.1717% -68 - C3 -4LFU - SDIA_ECOLI -
41 HHSearch 57.8315% -99 - C5 -2Q0O - TRAR_RHISN -
5 PsiBlast_PDB 57.6437% -64 - C5 -1FSE - GERE_BACSU -
43 HHSearch 57.5213% -89 * C7 *1L3L - TRAR_RHIRD -
26 PsiBlast_CBE 56.3037% -61 - C5 -1FSE - GERE_BACSU -
61 Fugue 56.1531% -78 - C5 -1FSE - GERE_BACSU -
27 PsiBlast_CBE 55.4337% -61 - C5 -1FSE - GERE_BACSU -
45 HHSearch 55.2132% -72 - C5 -1YIO - ? -
24 PsiBlast_CBE 54.9037% -63 - C5 -1FSE - GERE_BACSU -
38 PsiBlast_CBE 54.6933% -47 - C5 -3C3W - DEVR_MYCTU -
37 PsiBlast_CBE 54.6033% -48 - C5 -3C3W - DEVR_MYCTU -
25 PsiBlast_CBE 54.5037% -61 - C5 -1FSE - GERE_BACSU -
11 PsiBlast_PDB 54.4630% -94 - C5 -3P7N - ? -
54 HHSearch 54.3130% -67 - C5 -1JE8 4.8 NARL_ECOLI
51 HHSearch 54.1131% -72 - C5 -1A04 - NARL_ECOLI -
56 HHSearch 54.0933% -74 - C5 -1FSE - GERE_BACSU -