@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA5163: (2016-03-05 )
MKRKGIILAGGSGTRLHPATLAISKQLLPVYDKPMIYYPLSTLMLAGIREILIISTPQDTPRFQQLLGDGSNWGLDLQYAVQPSPDGLAQAFLIGESFIGNDLSALVLGDNLYYGHDFHELLGSASQRQTGASVFAYHVLDPERYGVVEFDQGGKAISLEEKPLEPKSNYAVTGLYFYDQQVVDIARDLKPSPRGELEITDVNRAYLERGQLSVEIMGRGYAWLDTGTHDSLLEAGQFIATLENRQGLKVACPEEIAYRQKWIDAAQLEKLAAPLAKNGYGQYLKRLLTETVY

Atome Classification :

(73 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

N5Y_B_8(4ASY)
?
[Raw transfer]




GOL_C_14(4B3U)
?
[Raw transfer]




Y46_C_9(3ZLK)
?
[Raw transfer]




Y46_D_11(3ZLK)
?
[Raw transfer]




N6A_B_8(4ASJ)
?
[Raw transfer]




N6A_C_10(4ASJ)
?
[Raw transfer]




N6A_A_5(4ASJ)
?
[Raw transfer]




HNR_B_8(4ARW)
?
[Raw transfer]




BBE_D_11(4B5B)
?
[Raw transfer]




N5Y_C_11(4ASY)
?
[Raw transfer]




HNR_D_16(4ARW)
?
[Raw transfer]




KKT_C_10(4B4G)
?
[Raw transfer]




942_B_8(4B42)
?
[Raw transfer]




Y46_B_7(3ZLK)
?
[Raw transfer]




N6A_D_13(4ASJ)
?
[Raw transfer]




N5Y_D_14(4ASY)
?
[Raw transfer]




942_D_14(4B42)
?
[Raw transfer]




BBE_C_9(4B5B)
?
[Raw transfer]




BBE_B_7(4B5B)
?
[Raw transfer]




HNR_C_12(4ARW)
?
[Raw transfer]




N5Y_A_5(4ASY)
?
[Raw transfer]




GOL_A_7(4B3U)
?
[Raw transfer]




BBE_A_5(4B5B)
?
[Raw transfer]




942_C_11(4B42)
?
[Raw transfer]




KKT_B_7(4B4G)
?
[Raw transfer]




TRH_O_15(1G3L)
?
[Raw transfer]




942_A_5(4B42)
?
[Raw transfer]




JWT_D_14(4B4M)
?
[Raw transfer]




JWT_A_5(4B4M)
?
[Raw transfer]




KKT_D_13(4B4G)
?
[Raw transfer]




JWT_C_11(4B4M)
?
[Raw transfer]




KKT_A_5(4B4G)
?
[Raw transfer]




TRH_K_11(1G3L)
?
[Raw transfer]




THM_D_20(1H5R)
RMLA1_ECOLI
[Raw transfer]




JWT_B_8(4B4M)
?
[Raw transfer]




TYD_D_12(1H5T)
RMLA1_ECOLI
[Raw transfer]




BZ0_C_11(4B2W)
?
[Raw transfer]




TYD_A_13(1LVW)
?
[Raw transfer]




BZ0_A_5(4B2W)
?
[Raw transfer]




TYD_A_6(1H5T)
RMLA1_ECOLI
[Raw transfer]




THM_C_18(1H5R)
RMLA1_ECOLI
[Raw transfer]




NIQ_B_7(4B2X)
?
[Raw transfer]




BZ0_B_8(4B2W)
?
[Raw transfer]




BZ0_D_14(4B2W)
?
[Raw transfer]




TRH_Q_17(1G3L)
?
[Raw transfer]




TMP_C_9(1H5S)
RMLA1_ECOLI
[Raw transfer]




TRH_M_13(1G3L)
?
[Raw transfer]




TYD_C_10(1H5T)
RMLA1_ECOLI
[Raw transfer]




NIQ_D_11(4B2X)
?
[Raw transfer]




NIQ_C_9(4B2X)
?
[Raw transfer]




THM_A_14(1H5R)
RMLA1_ECOLI
[Raw transfer]




TTP_K_11(1IIM)
RMLA_SALTY
[Raw transfer]




GJB_B_8(4B4B)
?
[Raw transfer]




NIQ_A_5(4B2X)
?
[Raw transfer]




GJB_A_5(4B4B)
?
[Raw transfer]




NWL_A_5(4B3U)
?
[Raw transfer]




NWL_C_12(4B3U)
?
[Raw transfer]




GJB_D_14(4B4B)
?
[Raw transfer]




NWL_B_9(4B3U)
?
[Raw transfer]




GJB_C_11(4B4B)
?
[Raw transfer]




NWL_D_17(4B3U)
?
[Raw transfer]




4WF_D_17(3ZLL)
?
[Raw transfer]




4WF_C_14(3ZLL)
?
[Raw transfer]




4WF_B_10(3ZLL)
?
[Raw transfer]




73 PsiBlast_CBE 96.76100%-119 - C1 -1G1L - ? -
68 PsiBlast_CBE 96.76100%-119 - C1 -1G2V - ? -
58 PsiBlast_CBE 96.71100%-125 - C1 -4ARW 5.2 ?
63 PsiBlast_CBE 96.52100%-117 - C1 -1G2V - ? -
69 PsiBlast_CBE 96.45100%-118 - C1 -1G2V - ? -
44 PsiBlast_CBE 96.40100%-122 - C1 -4B2W 5.5 ?
88 PsiBlast_CBE 96.27100%-120 - C1 -1FZW - ? -
5 PsiBlast_PDB 96.20100%-121 - C1 -4B4G 5.4 ?
51 PsiBlast_CBE 96.13100%-117 - C1 -4ASY 6.2 ?
4 PsiBlast_PDB 96.10100%-119 - C1 -4B4B 4.1 ?
72 PsiBlast_CBE 96.09100%-117 - C1 -1G1L - ? -
2 PsiBlast_PDB 96.07100%-120 - C1 -4B3U 4.8 ?
64 PsiBlast_CBE 96.04100%-117 - C1 -1G2V - ? -
67 PsiBlast_CBE 96.02100%-117 - C1 -1G2V - ? -
14 PsiBlast_PDB 95.88100%-118 - C1 -1G3L 5.5 ?
74 PsiBlast_CBE 95.85100%-118 - C1 -1G1L - ? -
65 PsiBlast_CBE 95.85100%-118 - C1 -1G2V - ? -
17 PsiBlast_PDB 95.7998%-121 - C1 -1G23 - ? -
25 PsiBlast_CBE 95.75100%-120 - C1 -4B4M 6.6 ?
30 PsiBlast_CBE 95.74100%-118 - C1 -4B4B 3.7 ?
23 PsiBlast_CBE 95.73100%-119 - C1 -4B5B 5.9 ?
8 PsiBlast_PDB 95.72100%-119 - C1 -4B2W 5.6 ?
29 PsiBlast_CBE 95.66100%-124 - C1 -4B4G 5.9 ?
49 PsiBlast_CBE 95.64100%-122 - C1 -3ZLK 6.2 ?
37 PsiBlast_CBE 95.62100%-119 - C1 -4B3U 4.2 ?
6 PsiBlast_PDB 95.57100%-120 - C1 -4B4M 6.3 ?
46 PsiBlast_CBE 95.54100%-118 - C1 -3ZLL 3.7 ?
1 PsiBlast_PDB 95.53100%-120 - C1 -4B2X 5.0 ?
7 PsiBlast_PDB 95.51100%-118 - C1 -4B5B 6.2 ?
32 PsiBlast_CBE 95.50100%-120 - C1 -4B4B 4.0 ?
40 PsiBlast_CBE 95.45100%-120 - C1 -4B2X 4.5 ?
61 PsiBlast_CBE 95.41100%-118 - C1 -1G3L 5.5 ?
27 PsiBlast_CBE 95.33100%-118 - C1 -4B4G 5.0 ?
31 PsiBlast_CBE 95.25100%-118 - C1 -4B4B 4.0 ?
24 PsiBlast_CBE 95.25100%-117 - C1 -4B4M 6.3 ?
41 PsiBlast_CBE 95.22100%-119 - C1 -4B2X 4.8 ?
38 PsiBlast_CBE 95.21100%-118 - C1 -4B3U 4.9 ?
60 PsiBlast_CBE 95.19100%-119 - C1 -1G3L 5.6 ?
57 PsiBlast_CBE 95.16100%-118 - C1 -4ARW 5.1 ?
39 PsiBlast_CBE 95.15100%-116 - C1 -4B2X 5.0 ?
47 PsiBlast_CBE 95.14100%-119 - C1 -3ZLL 3.7 ?
62 PsiBlast_CBE 95.03100%-119 - C1 -1G3L 5.4 ?
50 PsiBlast_CBE 94.85100%-118 - C1 -3ZLK 6.2 ?
36 PsiBlast_CBE 94.85100%-117 - C1 -4B3U 4.7 ?
43 PsiBlast_CBE 94.83100%-123 - C1 -4B2W 5.7 ?
48 PsiBlast_CBE 94.80100%-119 - C1 -3ZLK 6.3 ?
52 PsiBlast_CBE 94.77100%-118 - C1 -4ASY 6.0 ?
26 PsiBlast_CBE 94.77100%-117 - C1 -4B4M 5.8 ?
15 PsiBlast_PDB 94.73100%-120 - C1 -4ASJ 5.9 ?
53 PsiBlast_CBE 94.68100%-117 - C1 -4ASY 6.0 ?
33 PsiBlast_CBE 94.67100%-118 - C1 -4B42 5.0 ?
21 PsiBlast_CBE 94.63100%-116 - C1 -4B5B 6.2 ?
34 PsiBlast_CBE 94.58100%-119 - C1 -4B42 5.0 ?
55 PsiBlast_CBE 94.55100%-117 - C1 -4ASJ 5.8 ?
45 PsiBlast_CBE 94.47100%-117 - C1 -3ZLL 3.5 ?
59 PsiBlast_CBE 94.26100%-118 - C1 -4ARW 5.2 ?
22 PsiBlast_CBE 94.09100%-119 - C1 -4B5B 6.5 ?
3 PsiBlast_PDB 94.08100%-117 - C1 -4B42 4.8 ?
54 PsiBlast_CBE 93.48100%-117 - C1 -4ASJ 6.4 ?
42 PsiBlast_CBE 93.43100%-119 - C1 -4B2W 5.5 ?
28 PsiBlast_CBE 93.42100%-117 - C1 -4B4G 5.4 ?
35 PsiBlast_CBE 93.35100%-119 - C1 -4B42 5.3 ?
16 PsiBlast_PDB 92.93100%-116 - C1 -4ASY 5.9 ?
56 PsiBlast_CBE 92.70100%-118 - C1 -4ASJ 6.3 ?
98 PsiBlast_CBE 85.9875%-114 - C1 -1H5T 4.4 RMLA1_ECOLI
99 PsiBlast_CBE 85.9575%-114 - C1 -1H5T 4.5 RMLA1_ECOLI
101 PsiBlast_CBE 85.6175%-113 - C1 -1H5R 3.9 RMLA1_ECOLI
18 PsiBlast_PDB 85.3575%-115 - C1 -1H5T 4.3 RMLA1_ECOLI
100 PsiBlast_CBE 85.1375%-115 - C1 -1H5R 3.5 RMLA1_ECOLI
20 PsiBlast_PDB 85.1175%-117 - C1 -1H5S 4.7 RMLA1_ECOLI
114 HHSearch 84.1374%-113 * C1 *1IIM 4.1 RMLA_SALTY
19 PsiBlast_PDB 84.1375%-112 - C1 -1H5R 3.9 RMLA1_ECOLI
112 HHSearch 82.0960%-115 - C1 -1LVW 5.8 ?