@TOME V2.3
(Nov 2016)

Ref. - - Doc.
Global output mode :
Sort entries by :
Sequence Color type :

Show alignment :
Column output:
Score:

Alignment:

3D Common Core:

Structural Clustering:

Modeller Result :

Complexes Modeling
Templates Information:
Sequence & Result Tab:

Values color: [ Good | Correct | Middling | Bad ]Comparative Docking Tab: Displays ligands Score after transfer from template to model
Cell color: RMS between binding site of experimental template and receptor: [‹ 3Å | ‹ 10Å | › 10Å]
Result: [ Good | Correct | Acceptable | Bad | Empty = ligand not selected during the calculation step or result rejected ]

Query sequence : PA5521: (2016-03-08 )
MSTPVVLITGAAGGLGRAIAKRFAQSHWRIAATDVDKEGLHALNAQVPLDASGVADLRSADNCHTLMSKILARTGRLDALVNAAGVWREGPVENFTEEDFDLVLGVNLKASFYMCQAAIPYLKENQGSIVNISSDSGRQAYRGSAAYCASKAALTMLSKTLALELAEQGVRVNAVSPADIATPMLDYQAERYGMGNPDGYKRALLKDYPQGKAARFIRPEEVAELVWYLCGPQAEAITGADLAVDFGLSAGR

Atome Classification :

(21 SA) Binding Score for complex ligand / Scwrl (Unconserved SChains Recalculated) model (Only selected ligand are displayed)
(Atome) (Ident) (Tito) (Num) (pKd) (Uniprot)

NAP_G_7(2BD0)
SPRE_CHLTE
[Raw transfer]




64 PsiBlast_CBE 84.3631%-102 - C1 -2C07 - ? -
99 PsiBlast_CBE 80.6633%-102 - C1 -2PNF - FABG_AQUAE -
100 PsiBlast_CBE 80.4833% -99 - C1 -2PNF - FABG_AQUAE -
15 PsiBlast_PDB 80.2733% -99 - C1 -1X7G - ACT3_STRCO -
19 PsiBlast_PDB 80.1133% -98 - C1 -2RHC - ACT3_STRCO -
50 PsiBlast_CBE 79.9533%-101 - C1 -4DBZ - ACT3_STRCO -
45 PsiBlast_CBE 79.3433% -98 - C1 -1W4Z - ACT3_STRCO -
54 PsiBlast_CBE 79.3133%-102 - C1 -4DC1 - ACT3_STRCO -
41 PsiBlast_CBE 79.2833%-100 - C1 -1X7H - ACT3_STRCO -
20 PsiBlast_PDB 79.0933%-104 - C1 -1W4Z - ACT3_STRCO -
6 PsiBlast_PDB 79.0033%-104 - C1 -4K6C - ? -
23 PsiBlast_CBE 78.6933%-103 - C1 -3GK3 - ? -
132 HHSearch 78.5335% -93 - C1 -2D1Y - ? -
52 PsiBlast_CBE 78.5033%-100 - C1 -4DC0 - ACT3_STRCO -
36 PsiBlast_CBE 78.4933% -99 - C1 -3RI3 - ACT3_STRCO -
32 PsiBlast_CBE 77.9033%-103 - C1 -3SJ7 - ? -
16 PsiBlast_PDB 77.7733% -99 - C1 -1X7H - ACT3_STRCO -
22 PsiBlast_CBE 77.7433%-109 - C1 -3GK3 - ? -
13 PsiBlast_PDB 77.7333%-100 - C1 -3RI3 - ACT3_STRCO -
31 PsiBlast_CBE 77.7234% -92 - C1 -4NBW - ? -
102 PsiBlast_CBE 42.1636% -87 - C1 -2BD0 11.8 SPRE_CHLTE