Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKISRILLAAVILSSVFSITYLQSDHNTEIKVAADRVGA 4N8F Chain:A ((36-49)) -------------------------FLPDYEVAADTVGA

General information: TITO was launched using: RESULT: Template: 4N8F.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 1 -128 -128.00 -9.14 target 2D structure prediction score : 0.86 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : -128.00 2D Compatibility (Sec. Struct. Predict.) : 0.86 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.372

(partial model without unconserved sides chains): PDB file : Tito_4N8F.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4N8F-query.scw PDB file : Tito_Scwrl_4N8F.pdb: