Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MPSTVINLYYLKINSISGNGSITIGEAAYNSPTNNQKSQGTNSSFGDTSPTESVMENFLNDPDVNDQTSIGNSDTSNVNAPPIAPPPILD 2WZP Chain:P ((230-263)) -------------------------------------------------KTEQVQDYILINTDVNDETYQGWKGTTALNLFPV-------

General information: TITO was launched using: RESULT: Template: 2WZP.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain P - contact count / total energy / energy per contact / energy per residue : 85 -1 -0.01 -0.01 target 2D structure prediction score : 0.38 Monomeric hydrophicity matching model chain P : 0.58 3D Compatibility (PKB) : -0.01 2D Compatibility (Sec. Struct. Predict.) : 0.38 1D Compatibility (Hydrophobicity) : 0.58 QMean score : 0.157

(partial model without unconserved sides chains): PDB file : Tito_2WZP.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2WZP-query.scw PDB file : Tito_Scwrl_2WZP.pdb: