Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MARKCVITGKKTTAGNNRSHAMNASKRTWGANLQKVRILVNGKPKKVYVSARALKSGKVERV 4WCE Chain:U ((10-55)) ---------RKASTGNRRSHALNSTKRRWNANLQKVRILVDGKPKKVWVSARALK-------

General information: TITO was launched using: RESULT: Template: 4WCE.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain U - contact count / total energy / energy per contact / energy per residue : 90 5476 60.84 119.04 target 2D structure prediction score : 0.72 Monomeric hydrophicity matching model chain U : 0.85 3D Compatibility (PKB) : 60.84 2D Compatibility (Sec. Struct. Predict.) : 0.72 1D Compatibility (Hydrophobicity) : 0.85 QMean score : 0.406

(partial model without unconserved sides chains): PDB file : Tito_4WCE.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4WCE-query.scw PDB file : Tito_Scwrl_4WCE.pdb: