Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceIDCGHVDSLVRPCLSYVQGG-PGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNL-NEDNARSIPPKCGVNLPYTISLNIDCSRV
1BWO Chain:A ((1-90))IDCGHVDSLVRPCLSYVQGGP-GPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHNLN-EDNARSIPPKCGVNLPYTISLNIDCSRV


General information:
TITO was launched using:
RESULT:

Template: 1BWO.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -55527 for 603 contacts (-92.1/contact) +
2D Compatibility (PS) -9147 + (NN) -2400 + (LL) -220
1D Compatibility (HY) -11600 + (ID) 4400
Total energy: -83294.0 ( -138.13 by residue)
QMean score : 0.413

(partial model without unconserved sides chains):
PDB file : Tito_1BWO.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-1BWO-query.scw
PDB file : Tito_Scwrl_1BWO.pdb: