Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMQLCVALDLEKKEDNLSLLQELKGLDLWAKVGLRSFIRDGATFLDEIRKIDGNFKIFLDLKLYDIPYTMANAALECAKLDIDMLTVHLSSAKSALTILMQRLNALKKRPLIMGVSALTSFSEEEFLMVYNAPLKTQAITLSAIGKESGIDGVVCSVFESLAIKEALGKGFLTLTPGIRLDKNDKEDQERVANAKEAKQNLSDFIVVGRPIYQAKEPREVVLELLKDC
3RU6 Chain:A ((25-247))MKLCVALDLSTKEECLQLAKELKNLDIWLKVGLRAYLRDGFKFIEELKKVD-DFKIFLDLKFHDIPNTMADACEEVSKLGVDMINIHASAGKIAIQEVMTRLSKFSKRPLVLAVSALTSFDEENFFSIYRQKIEEAVINFSKISYENGLDGMVCSVFESKKIKEHTSSNFLTLTPGIRPFG--------VANLAMARENLSDYIVVGRPIYKNENPRAVCEKILNKI


General information:
TITO was launched using:
RESULT:

Template: 3RU6.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -174010 for 1763 contacts (-98.7/contact) +
2D Compatibility (PS) -23614 + (NN) -9893 + (LL) 88
1D Compatibility (HY) -26000 + (ID) 5900
Total energy: -239329.0 ( -135.75 by residue)
QMean score : 0.654

(partial model without unconserved sides chains):
PDB file : Tito_3RU6.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3RU6-query.scw
PDB file : Tito_Scwrl_3RU6.pdb: