Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMEIKMAKDYGFCFGVKRAIQIAEKNQNS-----LIFGSLIHNAKEINRLEKNFNVKIEEDPKKIPKNKSVIIRTHGIPKQDLEYLKNKGVKITDATCPYVIKPQQIVESMSKEGYQIVLFGDINHPEVKGVISY---ATNQALVVNSLEELQEKKLQRKVALVSQTTKQTPKLLQIASYLVERCTEVRIFNTICNATSYNQKAALDLSKEVDIMIVVGGKTSSNTKQLLSIAKQHCKDSYLVEDENELELAWFKDKKLCGITAGASTPDWIIENVKQKISTI
3DNF Chain:A ((2-281))VDIIIAEHAGFCFGVKRAVKLAEESLKESQGKVYTLGPIIHNPQEVNRL-KNLGV-FPSQGEEFKEGDTVIIRSHGIPPEKEEALRKKGLKVIDATCPYVKAVHEAVCQLTREGYFVVLVGEKNHPEVIGTLGYLRACNGKGIVVETLEDIGEALKHERVGIVAQTTQNEEFFKEVVGEIALWVKEVKVINTICNATSLRQESVKKLAPEVDVMIIIGGKNSGNTRRLYYISKELNPNTYHIETAEELQPEWFRGVKRVGISAGASTPDWIIEQVKSRIQEI


General information:
TITO was launched using:
RESULT:

Template: 3DNF.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -136529 for 2199 contacts (-62.1/contact) +
2D Compatibility (PS) -29141 + (NN) -7646 + (LL) 168
1D Compatibility (HY) -25200 + (ID) 5900
Total energy: -204248.0 ( -92.88 by residue)
QMean score : 0.567

(partial model without unconserved sides chains):
PDB file : Tito_3DNF.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3DNF-query.scw
PDB file : Tito_Scwrl_3DNF.pdb: