Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMSLPKDLLYTEEHEWVKAD-DGSYVIGITDFAQDQLGDIVFVELPEVGDTVTKGDSIGSIESVKTVSDFYAPVTGKVVAVNETLEDEPELINSNPYDTGWILKLEEVEEADVKALLSSDDYEKVLD
3A7A Chain:B ((2-126))-NVPAELKYSKEHEWLRKEADGTYTVGITEHAQELLGDMVFVDLPEVGATVSAGDDCAVAESVKAASDIYAPVSGEIVAVNDALSDSPELVNSEPYAGGWIFKIKASDESELESLLDATAYEALLE


General information:
TITO was launched using:
RESULT:

Template: 3A7A.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -43010 for 948 contacts (-45.4/contact) +
2D Compatibility (PS) -12913 + (NN) -2240 + (LL) 208
1D Compatibility (HY) -12800 + (ID) 3200
Total energy: -73955.0 ( -78.01 by residue)
QMean score : 0.614

(partial model without unconserved sides chains):
PDB file : Tito_3A7A.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3A7A-query.scw
PDB file : Tito_Scwrl_3A7A.pdb: