Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMNSLNGETLLTGLIANPARHSLSPLMWNTSFQEKNMNYAYLTFEVEEGKLTEAVRGVRALGIRGVNVSMPFKQSVIPLLDDLSPQAKLVGAVNTIVNQGGTGRLVGHMTDGIGCFKALAAQGFSAKNKIVTIAGIGGSGKAVAVQAAMEGVAEIRLFNRNSSNYDKVIDLSDKIKKQFQIKVVVDYLENKTAFKDAIRTSHFYIDATSLGMRPLDNYSLINDPEILTPNLVVVDLVYKPKETALLRFVRQNGVKHAYNGLGMLIYQGAEAFQLITNQEMPISSVERVLQTEN
3TOZ Chain:A ((33-314))---ITGHTELIGLIATPIRHSLSPTMHNEAFAKLGLDYVYLAFEVGDKELKDVVQGFRAMNLRGWNVSMPNKTNIHKYLDKLSPAAELVGAVNTVVNDDGV--LTGHITDGTGYMRALKEAGHDIIGKKMTICGAGGAATAICIQAALDGVKEISIFNRKDDFYANAEKTVEKINSKTDCKAQLFDIEDHEQLRKEIAESVIFTNATGVGMKPFEGETLLPSADMLRPELIVSDVVYKPTKTRLLEIAEEQGCQ-TLNGLGMMLWQGAKAFEIWTHKEMPVDYIKEILF---


General information:
TITO was launched using:
RESULT:

Template: 3TOZ.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -204252 for 2442 contacts (-83.6/contact) +
2D Compatibility (PS) -30674 + (NN) -12786 + (LL) 348
1D Compatibility (HY) -25200 + (ID) 6000
Total energy: -278564.0 ( -114.07 by residue)
QMean score : 0.661

(partial model without unconserved sides chains):
PDB file : Tito_3TOZ.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3TOZ-query.scw
PDB file : Tito_Scwrl_3TOZ.pdb: