Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MSEALTFESKYALLYLGGGLLAMIYGLITFFMAFPAFTSRGNVIFTIKTGPSGEIFLRKRSVLFSEVKRLYMGRHQYSLKGIFFEDIIIEKTDGKIVRIPTWNIITNPLFFEAVERYILPHLNEEAQNNWISQFTEVQRKAYLKEFENHPKL 1RH9 Chain:A ((284-303)) ----------------------------------------------------------------------------------------------------------------------LPGLTQEAQDKWASQWIQVH--------------

General information: TITO was launched using: RESULT: Template: 1RH9.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 13 -1818 -139.81 -90.88 target 2D structure prediction score : 0.75 Monomeric hydrophicity matching model chain A : 0.48 3D Compatibility (PKB) : -139.81 2D Compatibility (Sec. Struct. Predict.) : 0.75 1D Compatibility (Hydrophobicity) : 0.48 QMean score : 0.531

(partial model without unconserved sides chains): PDB file : Tito_1RH9.pdb: (Unconserved sides chains are recalculated) : Sequence: align-1RH9-query.scw PDB file : Tito_Scwrl_1RH9.pdb: