Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYHYFYGPALIPYFSHTHNPQRSPDFSERQRRREITLTVDGFVPPSSTEDLGDGFYSYAWTNQQVINPG--EYLVCHLEGRDINVINGGFTPRDTAPLYAVASFPRRRNQWVIIIHNPVQTQRAISLYLIAKR 3DBR Chain:B ((158-215)) ---------------------------------------DGVLDPSSIVPLIDGGTEGFKGNAQVILPGMTACIECTLE---------LYPPQVNFPMATIASMPR---------------------------

General information: TITO was launched using: RESULT: Template: 3DBR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 84 -5015 -59.70 -89.55 target 2D structure prediction score : 0.50 Monomeric hydrophicity matching model chain B : 0.61 3D Compatibility (PKB) : -59.70 2D Compatibility (Sec. Struct. Predict.) : 0.50 1D Compatibility (Hydrophobicity) : 0.61 QMean score : 0.152

(partial model without unconserved sides chains): PDB file : Tito_3DBR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3DBR-query.scw PDB file : Tito_Scwrl_3DBR.pdb: