Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MKEQTPIRKAVALHYDEQKDKAPRVIATGKGHVADNIIKEAKKAGVPIQEDRTLVE-LMRHLTVDDQIPEALYETVAEIFSFIYKLDESVKNKK 3B0Z Chain:B ((1-81)) -----PTHYSVALQYDENKMSAPKVVAKGAGLIALRIREIGAEHRVPTLEAPPLARALYRHAEIGQQIPGQLYAAVAEVLAWVWQL--------

General information: TITO was launched using: RESULT: Template: 3B0Z.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain B - contact count / total energy / energy per contact / energy per residue : 268 -41346 -154.27 -516.82 target 2D structure prediction score : 0.58 Monomeric hydrophicity matching model chain B : 0.80 3D Compatibility (PKB) : -154.27 2D Compatibility (Sec. Struct. Predict.) : 0.58 1D Compatibility (Hydrophobicity) : 0.80 QMean score : 0.655

(partial model without unconserved sides chains): PDB file : Tito_3B0Z.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3B0Z-query.scw PDB file : Tito_Scwrl_3B0Z.pdb: