Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MNGIAWMIVFCEIAFWVVIVLGLAVRYVFKRHTLGLLFLALTP----VIDLI---LLAATGVDLYRGASATAAHGIAAVYIGISIAYGKQMIQWADEKFQYYVTKKGTKPLKRFGMDHAKHGAKGWLRHVLAYLIGAGLLAGMIYFINDSSRTEALSGILKLWTVIIGIDFLITASYFIWPKKEKASANLRS 2V3U Chain:A ((69-164)) ---------------------GLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRGTSIQSLQDLSK---QTDIPYGTVL----DSAVYQHVRMKGLNPFERDSM----------------------------------------------------------------------------

General information: TITO was launched using: RESULT: Template: 2V3U.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 173 -26159 -151.21 -322.94 target 2D structure prediction score : 0.26 Monomeric hydrophicity matching model chain A : 0.54 3D Compatibility (PKB) : -151.21 2D Compatibility (Sec. Struct. Predict.) : 0.26 1D Compatibility (Hydrophobicity) : 0.54 QMean score : -0.036

(partial model without unconserved sides chains): PDB file : Tito_2V3U.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2V3U-query.scw PDB file : Tito_Scwrl_2V3U.pdb: