Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MTLWVGILVGVVALLIGVALGFFIARKYMMSYLKKNPPINEQMLRMMMMQMGMKPSQKKINQMMKAMNNQTK 5GAR Chain:N ((357-389)) --FWFGMIVGD----IGYALLFYLVGRWLSGYVKRNEPL---------------------------------

General information: TITO was launched using: RESULT: Template: 5GAR.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain N - contact count / total energy / energy per contact / energy per residue : 25 -6574 -262.94 -199.20 target 2D structure prediction score : 0.52 Monomeric hydrophicity matching model chain N : 0.68 3D Compatibility (PKB) : -262.94 2D Compatibility (Sec. Struct. Predict.) : 0.52 1D Compatibility (Hydrophobicity) : 0.68 QMean score : 0.419

(partial model without unconserved sides chains): PDB file : Tito_5GAR.pdb: (Unconserved sides chains are recalculated) : Sequence: align-5GAR-query.scw PDB file : Tito_Scwrl_5GAR.pdb: