Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MYKADYKQIAATPSFQAFLKQKRAFIVPSAIFFFVFYFSLPVLTSYFTFLNAPAIGAVSWAWLFAIAQFAMTWILSTVYSRRA---AHFDKYVSALKEDLKGEQT 2N28 Chain:A ((11-53)) -------------------------------------------------------------LVVAIIIAIVVWSIVIIEYRKILRQRKIDRLIDRLIERAEDSG-

General information: TITO was launched using: RESULT: Template: 2N28.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 17 -1511 -88.88 -37.78 target 2D structure prediction score : 0.65 Monomeric hydrophicity matching model chain A : 0.50 3D Compatibility (PKB) : -88.88 2D Compatibility (Sec. Struct. Predict.) : 0.65 1D Compatibility (Hydrophobicity) : 0.50 QMean score : 0.179

(partial model without unconserved sides chains): PDB file : Tito_2N28.pdb: (Unconserved sides chains are recalculated) : Sequence: align-2N28-query.scw PDB file : Tito_Scwrl_2N28.pdb: