Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence MQQACIAIIIILLTVAAYLAMVKLYKRFPLPFLIPVLTTTILIVAALMMFHVSYEGYMIGGKWINSLLGPAVVALAYPLYKQWHIIVKHCVPILGGVLVGLCMGMISGLIFAEAFGIDHDLLLSILPKSITTPVAIQIAAGLGGVPSMTVVFVMIAGFSGVILGPLFLKWLRIRSSLGQGIA---LGSASHALGTSKALEYGELAVSMSSVSMTLCAVLGSFFGPL---VVWLFHI 3J27 Chain:A ((381-457)) ---------------------------------------------------------------------------------------------------------------------------------------------------------------GVEPGQLKLNWFKKGSSIGQMIETTMRGAKRMAILGDTAWDFGSLGGVFTSIGKALHQVFGAIYGAAFSGVSWIMKI

General information: TITO was launched using: RESULT: Template: 3J27.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain A - contact count / total energy / energy per contact / energy per residue : 92 -14345 -155.92 -202.04 target 2D structure prediction score : 0.28 Monomeric hydrophicity matching model chain A : 0.45 3D Compatibility (PKB) : -155.92 2D Compatibility (Sec. Struct. Predict.) : 0.28 1D Compatibility (Hydrophobicity) : 0.45 QMean score : -0.161

(partial model without unconserved sides chains): PDB file : Tito_3J27.pdb: (Unconserved sides chains are recalculated) : Sequence: align-3J27-query.scw PDB file : Tito_Scwrl_3J27.pdb: