Modeling by threading (Tito software)
Unconserved sides chains calculation (Scwrl software)
Evaluation (QMean software)



Input alignment information:
Query sequenceMRPLARLRGRRVVPQRSAGELDAMAAAGAVVAAALRAIRAAAAPGTSSLSLDEIAESVIRESGATPSFLGYHGYPASICASINDRVVHGIPSTAEVLAPGDLVSIDCGAVLDGWHGDAAITFGVGALSDADEALSEATRESLQAGIAAMVVGNRLTDVAHAIETGTRAAELRYGRSFGIVAGYGGHGIGRQMHMDPFLPNEGAPGRGPLLAAGSVLAIEPMLTLGTTKTVVLDDKWTVTTADGSRAAHWEHTVAVTDDGPRILTLG
3TAV Chain:A ((29-284))---------KKTVEQRTPGELDAMAAAGSIVGAALVAVRDAAKAGVSTLELDQVAESVIREAGAVPSFLGYHGFPASICSSVNDQVVHGIPSATAVLADGDLVSIDCGAILDGWHGDSAWTFAVGTVIPSDEALSEATRLSMEAGIAAMIPGNRLTDVSHAIELGTRAAEKQFDRAFGIVDGYGGHGIGRSMHLDPFLPNEGAPGKGPLLAVGSVLAIEPMLTLGTTQTRVLADDWTVVTTDGSRAAHWEHTVAVTEAGPRILTM-


General information:
TITO was launched using:
RESULT:

Template: 3TAV.pdb
Alignment : align.pir
Tito was launched with SMD and SCWRL
Tito text output
3D Compatibility (PKB) -135683 for 2327 contacts (-58.3/contact) +
2D Compatibility (PS) -27969 + (NN) -11990 + (LL) 520
1D Compatibility (HY) -26800 + (ID) 9600
Total energy: -211522.0 ( -90.90 by residue)
QMean score : 0.562

(partial model without unconserved sides chains):
PDB file : Tito_3TAV.pdb:





(Unconserved sides chains are recalculated) :
Sequence: align-3TAV-query.scw
PDB file : Tito_Scwrl_3TAV.pdb: