Modeling by threading (Tito software) Unconserved sides chains calculation (Scwrl software) Evaluation (QMean software) Input alignment information: Query sequence -------------MRSQINISNLTINGMTQNANTDIGQNLQNSHTANSKN--------YGVNFTLGDYSPSHSII--ISASCDNDTSDQGQVDNPSSPSEE 4E5X Chain:G ((2-100)) KKVEFKEPACNVTFKSEANECTTLIKCTTEHEKLIIRHKDKIGKYAVYAIWQPGDTNDYNVTVFQGENRKTFMYKFPFYEMCDITMYMSKQYKLWPPQK--

General information: TITO was launched using: RESULT: Template: 4E5X.pdb Alignment : align.pir Tito was launched with SMD and SCWRL Tito text output Monomeric PKB - chain G - contact count / total energy / energy per contact / energy per residue : 259 -8193 -31.63 -107.80 target 2D structure prediction score : 0.54 Monomeric hydrophicity matching model chain G : 0.64 3D Compatibility (PKB) : -31.63 2D Compatibility (Sec. Struct. Predict.) : 0.54 1D Compatibility (Hydrophobicity) : 0.64 QMean score : 0.073

(partial model without unconserved sides chains): PDB file : Tito_4E5X.pdb: (Unconserved sides chains are recalculated) : Sequence: align-4E5X-query.scw PDB file : Tito_Scwrl_4E5X.pdb: